Gene/Proteome Database (LMPD)

LMPD ID
LMP010529
Gene ID
820768
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
lectin-like protein
Gene Symbol
AT3G15356
Alternate Names
lectin-like protein
Chromosome
3

Proteins

lectin-like protein
Refseq ID NP_683568
Protein GI 22331102
UniProt ID Q9LJR2
mRNA ID NM_148726
Length 271
RefSeq Status REVIEWED
MQIHKLCFLALFLANAAFAVKFNFDSFDGSNLLFLGDAELGPSSDGVSRSGALSMTRDETPFSHGQGLYINPIQFKSSNTSSPFDFKTSFTFSITPRTKPNSGQGLAFVIVPAADNSGASGGGYLGILNKTNDGKSENNLIFIEFDTFKNNESNDISGNHVGININSMTSLVAEKAGYWVQTLVGKRKVWSFKDVNLSSGERFKAWIEFRSKDSRNTITIAPENVKKPKRPLIQGSRVLNDVLLQNMYAGFAGSMGRAGERHDVWSWSFEN

Gene Information

Entrez Gene ID
820768
Gene Name
lectin-like protein
Gene Symbol
AT3G15356
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0048046 IDA:TAIR C apoplast
GO:0005618 IDA:TAIR C cell wall
GO:0030246 IEA:UniProtKB-KW F carbohydrate binding
GO:0071323 IEP:UniProtKB P cellular response to chitin
GO:0071369 IEP:UniProtKB P cellular response to ethylene stimulus
GO:0071395 IEP:UniProtKB P cellular response to jasmonic acid stimulus
GO:0009817 IDA:TAIR P defense response to fungus, incompatible interaction
GO:0009873 IEA:UniProtKB-KW P ethylene-activated signaling pathway
GO:0009611 IEP:UniProtKB P response to wounding

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-2161 folate polyglutamylation
PWY-2161B-PMN folate polyglutamylation II
PWY-3742 tetrahydrofolate biosynthesis II

Domain Information

InterPro Annotations

Accession Description
IPR013320 Concanavalin A-like lectin/glucanase domain
IPR016363 Lectin
IPR001220 Legume lectin domain

UniProt Annotations

Entry Information

Gene Name
lectin-like protein
Protein Entry
LECT2_ARATH
UniProt ID
Q9LJR2
Species
Arabidopsis

Comments

Comment Type Description
Function Plays a role in defense responses triggered by jasmonate, ethylene and chitin. {ECO:0000269|PubMed:19214436}.
Induction By oligogalacturonides and the diterpenoid compound sclareol. Accumulates in response to mechanical wounding, chitin, methyl jasmonate (MeJA) and ethylene (ET) stimuli. {ECO:0000269|PubMed:14526118, ECO:0000269|PubMed:18324730, ECO:0000269|PubMed:19214436}.
Sequence Caution Sequence=CAA62665.1; Type=Frameshift; Positions=260; Evidence={ECO:0000305};
Similarity Belongs to the leguminous lectin family. {ECO:0000305}.
Subcellular Location Secreted, extracellular space, apoplast {ECO:0000269|PubMed:18324730}.
Tissue Specificity Expressed in rosette leaves, inflorescences, roots, leaf veins, carpel heads, and silique receptacles. {ECO:0000269|PubMed:19214436}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010529 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22331102 RefSeq NP_683568 271 lectin-like protein

Identical Sequences to LMP010529 proteins

Reference Database Accession Length Protein Name
GI:22331102 DBBJ BAB02166.1 271 lectin-like protein [Arabidopsis thaliana]
GI:22331102 GenBank AAV85675.1 271 At3g15356 [Arabidopsis thaliana]
GI:22331102 GenBank AAX49372.1 271 At3g15356 [Arabidopsis thaliana]
GI:22331102 GenBank AEE75649.1 271 lectin-like protein [Arabidopsis thaliana]
GI:22331102 SwissProt Q9LJR2.1 271 RecName: Full=Lectin-like protein LEC; Short=AtLEC; Short=Ath.lec2; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010529 proteins

Reference Database Accession Length Protein Name
GI:22331102 EMBL CAA62665.1 272 lectin like protein [Arabidopsis thaliana]
GI:22331102 GenBank AAM98157.1 271 unknown protein [Arabidopsis thaliana]
GI:22331102 GenBank EFH61340.1 271 legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
GI:22331102 RefSeq XP_002885081.1 271 legume lectin family protein [Arabidopsis lyrata subsp. lyrata]
GI:22331102 RefSeq XP_010502809.1 283 PREDICTED: lectin-like protein LEC [Camelina sativa]
GI:22331102 RefSeq XP_010465493.1 273 PREDICTED: lectin-like protein LEC [Camelina sativa]