Gene/Proteome Database (LMPD)

LMPD ID
LMP010586
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
LysM domain-containing GPI-anchored protein 2
Gene Symbol
Synonyms
F6P23.25; F6P23_25; LYM2; lysm domain GPI-anchored protein 2 precursor
Alternate Names
LysM domain-containing GPI-anchored protein 2
Chromosome
2

Proteins

LysM domain-containing GPI-anchored protein 2
Refseq ID NP_565406
Protein GI 18398317
UniProt ID O23006
mRNA ID NM_127266
Length 350
RefSeq Status REVIEWED
METSCFTLLGLLVSLSFFLTLSAQMTGNFNCSGSTSTCQSLVGYSSKNATTLRNIQTLFAVKNLRSILGANNLPLNTSRDQRVNPNQVVRVPIHCSCSNGTGVSNRDIEYTIKKDDILSFVATEIFGGLVTYEKISEVNKIPDPNKIEIGQKFWIPLPCSCDKLNGEDVVHYAHVVKLGSSLGEIAAQFGTDNTTLAQLNGIIGDSQLLADKPLDVPLKACSSSVRKDSLDAPLLLSNNSYVFTANNCVKCTCDALKNWTLSCQSSSEIKPSNWQTCPPFSQCDGALLNASCRQPRDCVYAGYSNQTIFTTASPACPDSAGPDNYASTLSSSFNFVIVLIQCALLCLCLL

Gene Information

Entrez Gene ID
Gene Name
LysM domain-containing GPI-anchored protein 2
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 TAS:TAIR C anchored component of membrane
GO:0046658 IDA:TAIR C anchored component of plasma membrane
GO:0005886 IDA:TAIR C plasma membrane
GO:0009506 IDA:TAIR C plasmodesma
GO:0008061 IDA:TAIR F chitin binding
GO:0006952 IEA:UniProtKB-KW P defense response

Domain Information

InterPro Annotations

Accession Description
IPR018392 LysM domain

UniProt Annotations

Entry Information

Gene Name
LysM domain-containing GPI-anchored protein 2
Protein Entry
LYM2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Chitin elicitor-binding protein involved in the perception of chitin oligosaccharide elicitor. {ECO:0000269|PubMed:22891159}.
Similarity Contains 2 LysM repeats. {ECO:0000305}.
Subcellular Location Cell membrane; Lipid-anchor, GPI-anchor.
Subunit Forms homooligomers. Interacts with CERK1 (By similarity). Binds to chitin oligosaccharide elicitor. {ECO:0000250, ECO:0000269|PubMed:22891159}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010586 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18398317 RefSeq NP_565406 350 LysM domain-containing GPI-anchored protein 2

Identical Sequences to LMP010586 proteins

Reference Database Accession Length Protein Name
GI:18398317 GenBank AAL07070.1 350 unknown protein [Arabidopsis thaliana]
GI:18398317 GenBank AAL16233.1 350 delta-8 sphingolipid desaturase [Arabidopsis thaliana]
GI:18398317 GenBank AAM78070.1 350 At2g17120 [Arabidopsis thaliana]
GI:18398317 GenBank AEC06587.1 350 LysM domain-containing GPI-anchored protein 2 [Arabidopsis thaliana]
GI:18398317 SwissProt O23006.1 350 RecName: Full=LysM domain-containing GPI-anchored protein 2; AltName: Full=Chitin elicitor-binding protein LYM2; Short=CEBiP LYM2; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010586 proteins

Reference Database Accession Length Protein Name
GI:18398317 GenBank AAM65912.1 350 unknown [Arabidopsis thaliana]
GI:18398317 GenBank EFH60299.1 356 peptidoglycan-binding LysM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
GI:18398317 GenBank EOA30932.1 351 hypothetical protein CARUB_v10014079mg [Capsella rubella]
GI:18398317 RefSeq XP_002884040.1 356 peptidoglycan-binding LysM domain-containing protein [Arabidopsis lyrata subsp. lyrata]
GI:18398317 RefSeq XP_006298034.1 351 hypothetical protein CARUB_v10014079mg [Capsella rubella]
GI:18398317 RefSeq XP_010489327.1 363 PREDICTED: lysM domain-containing GPI-anchored protein 2-like [Camelina sativa]