Gene/Proteome Database (LMPD)
LMPD ID
LMP010586
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
LysM domain-containing GPI-anchored protein 2
Gene Symbol
Synonyms
F6P23.25; F6P23_25; LYM2; lysm domain GPI-anchored protein 2 precursor
Alternate Names
LysM domain-containing GPI-anchored protein 2
Chromosome
2
Proteins
LysM domain-containing GPI-anchored protein 2 | |
---|---|
Refseq ID | NP_565406 |
Protein GI | 18398317 |
UniProt ID | O23006 |
mRNA ID | NM_127266 |
Length | 350 |
RefSeq Status | REVIEWED |
METSCFTLLGLLVSLSFFLTLSAQMTGNFNCSGSTSTCQSLVGYSSKNATTLRNIQTLFAVKNLRSILGANNLPLNTSRDQRVNPNQVVRVPIHCSCSNGTGVSNRDIEYTIKKDDILSFVATEIFGGLVTYEKISEVNKIPDPNKIEIGQKFWIPLPCSCDKLNGEDVVHYAHVVKLGSSLGEIAAQFGTDNTTLAQLNGIIGDSQLLADKPLDVPLKACSSSVRKDSLDAPLLLSNNSYVFTANNCVKCTCDALKNWTLSCQSSSEIKPSNWQTCPPFSQCDGALLNASCRQPRDCVYAGYSNQTIFTTASPACPDSAGPDNYASTLSSSFNFVIVLIQCALLCLCLL |
Gene Information
Entrez Gene ID
Gene Name
LysM domain-containing GPI-anchored protein 2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0031225 | TAS:TAIR | C | anchored component of membrane |
GO:0046658 | IDA:TAIR | C | anchored component of plasma membrane |
GO:0005886 | IDA:TAIR | C | plasma membrane |
GO:0009506 | IDA:TAIR | C | plasmodesma |
GO:0008061 | IDA:TAIR | F | chitin binding |
GO:0006952 | IEA:UniProtKB-KW | P | defense response |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR018392 | LysM domain |
UniProt Annotations
Entry Information
Gene Name
LysM domain-containing GPI-anchored protein 2
Protein Entry
LYM2_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Function | Chitin elicitor-binding protein involved in the perception of chitin oligosaccharide elicitor. {ECO:0000269|PubMed:22891159}. |
Similarity | Contains 2 LysM repeats. {ECO:0000305}. |
Subcellular Location | Cell membrane; Lipid-anchor, GPI-anchor. |
Subunit | Forms homooligomers. Interacts with CERK1 (By similarity). Binds to chitin oligosaccharide elicitor. {ECO:0000250, ECO:0000269|PubMed:22891159}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010586 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18398317 | RefSeq | NP_565406 | 350 | LysM domain-containing GPI-anchored protein 2 |
Identical Sequences to LMP010586 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18398317 | GenBank | AAL07070.1 | 350 | unknown protein [Arabidopsis thaliana] |
GI:18398317 | GenBank | AAL16233.1 | 350 | delta-8 sphingolipid desaturase [Arabidopsis thaliana] |
GI:18398317 | GenBank | AAM78070.1 | 350 | At2g17120 [Arabidopsis thaliana] |
GI:18398317 | GenBank | AEC06587.1 | 350 | LysM domain-containing GPI-anchored protein 2 [Arabidopsis thaliana] |
GI:18398317 | SwissProt | O23006.1 | 350 | RecName: Full=LysM domain-containing GPI-anchored protein 2; AltName: Full=Chitin elicitor-binding protein LYM2; Short=CEBiP LYM2; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010586 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18398317 | GenBank | AAM65912.1 | 350 | unknown [Arabidopsis thaliana] |
GI:18398317 | GenBank | EFH60299.1 | 356 | peptidoglycan-binding LysM domain-containing protein [Arabidopsis lyrata subsp. lyrata] |
GI:18398317 | GenBank | EOA30932.1 | 351 | hypothetical protein CARUB_v10014079mg [Capsella rubella] |
GI:18398317 | RefSeq | XP_002884040.1 | 356 | peptidoglycan-binding LysM domain-containing protein [Arabidopsis lyrata subsp. lyrata] |
GI:18398317 | RefSeq | XP_006298034.1 | 351 | hypothetical protein CARUB_v10014079mg [Capsella rubella] |
GI:18398317 | RefSeq | XP_010489327.1 | 363 | PREDICTED: lysM domain-containing GPI-anchored protein 2-like [Camelina sativa] |