Gene/Proteome Database (LMPD)

LMPD ID
LMP010623
Gene ID
837254
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sterol 4-alpha-methyl-oxidase
Gene Symbol
SMO2-1
Synonyms
ATSMO2; F22G5.23; F22G5_23; SMO2-1; STEROL 4-ALPHA-METHYL-OXIDASE 2; sterol 4-alpha-methyl-oxidase 2-1
Alternate Names
sterol 4-alpha-methyl-oxidase
Chromosome
1
EC Number
1.14.13.72
Summary
Arabidopsis thaliana sterol 4-alpha-methyl-oxidase mRNA
Orthologs
View orthologs and multiple alignments for SMO2-1

Proteins

sterol 4-alpha-methyl-oxidase
Refseq ID NP_563789
Protein GI 18390767
UniProt ID Q8VWZ8
mRNA ID NM_100616
Length 266
RefSeq Status REVIEWED
MASFVESGWQYLVTHFSDFQLACIGSFLLHESVFFLSGLPFIFLERQGFLSKYKIQTKNNTPAAQGKCITRLLLYHFSVNLPLMLASYPVFRAMGMRSSFPLPSWKEVSAQILFYFIIEDFVFYWGHRILHSKWLYKNVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPALTGPHLITLWLWMVLRVLETVEAHCGYHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNYSSTFVYMDWIFGTDKGYRRLKTLKENGDMKQT
sterol 4-alpha-methyl-oxidase
Refseq ID NP_973777
Protein GI 42571373
UniProt ID Q8VWZ8
mRNA ID NM_202048
Length 228
RefSeq Status REVIEWED
MLLLPFMVNTYFSFVPMQTKNNTPAAQGKCITRLLLYHFSVNLPLMLASYPVFRAMGMRSSFPLPSWKEVSAQILFYFIIEDFVFYWGHRILHSKWLYKNVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPALTGPHLITLWLWMVLRVLETVEAHCGYHFPWSLSNFLPLYGGADFHDYHHRLLYTKSGNYSSTFVYMDWIFGTDKGYRRLKTLKENGDMKQT

Gene Information

Entrez Gene ID
837254
Gene Name
sterol 4-alpha-methyl-oxidase
Gene Symbol
SMO2-1
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009941 IDA:TAIR C chloroplast envelope
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0000254 IEA:UniProtKB-EC F C-4 methylsterol oxidase activity
GO:0005506 IEA:InterPro F iron ion binding
GO:0006633 IEA:InterPro P fatty acid biosynthetic process
GO:0016126 IEA:UniProtKB-KW P sterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01100 Metabolic pathways
ath00100 Steroid biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
6254036 Cholesterol biosynthesis
6254041 Synthesis of bile acids and bile salts

Domain Information

InterPro Annotations

Accession Description
IPR006694 Fatty_acid_hydroxylase

UniProt Annotations

Entry Information

Gene Name
sterol 4-alpha-methyl-oxidase
Protein Entry
SMO22_ARATH
UniProt ID
Q8VWZ8
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8VWZ8-1; Sequence=Displayed; Name=2; IsoId=Q8VWZ8-2; Sequence=VSP_041865;
Catalytic Activity 3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-arbaldehyde + NAD(P)H + O(2) = 3-beta-hydroxy-4- beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylate + NAD(P)(+) + H(2)O.
Catalytic Activity 4,4-dimethyl-5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + CA NAD(P)(+) + H(2)O.
Catalytic Activity 4-beta-hydroxymethyl-4-alpha-methyl-5-alpha- cholest-7-en-3-beta-ol + NAD(P)H + O(2) = 3-beta-hydroxy-4-beta- methyl-5-alpha-cholest-7-ene-4-alpha-carbaldehyde + NAD(P)(+) + 2 H(2)O.
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250};
Domain The histidine box domains may contain the active site and/or be involved in metal ion binding.
Function Non-heme iron oxygenase involved in sterols biosynthesis. 24-ethylidenelophenol and 24-ethyllophenol are the preferred substrates. {ECO:0000269|PubMed:11707264}.
Miscellaneous Requires a membrane-bound cytochrome b5 as an obligatory electron carrier from NAD(P)H to SMO.
Sequence Caution Sequence=AAF79571.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the sterol desaturase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010623 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18390767 RefSeq NP_563789 266 sterol 4-alpha-methyl-oxidase
42571373 RefSeq NP_973777 228 sterol 4-alpha-methyl-oxidase

Identical Sequences to LMP010623 proteins

Reference Database Accession Length Protein Name
GI:42571373 DBBJ BAH19532.1 228 AT1G07420 [Arabidopsis thaliana]
GI:18390767 EMBL CAR81286.1 266 unnamed protein product [Arabidopsis thaliana]
GI:18390767 EMBL CBX84764.1 266 unnamed protein product [Arabidopsis thaliana]
GI:18390767 GenBank ACI31310.1 266 At1g07420 [Arabidopsis thaliana]
GI:18390767 GenBank ACX17324.1 266 Sequence 44761 from patent US 7569389
GI:18390767 GenBank AEE28122.1 266 methylsterol monooxygenase [Arabidopsis thaliana]
GI:42571373 GenBank AEE28123.1 228 methylsterol monooxygenase [Arabidopsis thaliana]
GI:18390767 SwissProt Q8VWZ8.1 266 RecName: Full=Methylsterol monooxygenase 2-2; AltName: Full=Sterol 4-alpha-methyl-oxidase 1; Short=AtSMO1; AltName: Full=Sterol 4-alpha-methyl-oxidase 2-2 [Arabidopsis thaliana]

Related Sequences to LMP010623 proteins

Reference Database Accession Length Protein Name
GI:42571373 EMBL CAR81286.1 266 unnamed protein product [Arabidopsis thaliana]
GI:18390767 EMBL CAR81345.1 266 unnamed protein product [Arabidopsis thaliana]
GI:42571373 EMBL CAR81347.1 261 unnamed protein product [Arabidopsis thaliana]
GI:18390767 EMBL CBX84821.1 266 unnamed protein product [Arabidopsis thaliana]
GI:42571373 EMBL CBX84823.1 261 unnamed protein product [Arabidopsis thaliana]
GI:42571373 GenBank AAF79571.1 261 F22G5.23 [Arabidopsis thaliana]
GI:18390767 GenBank AAM64821.1 266 putative C-4 sterol methyl oxidase [Arabidopsis thaliana]
GI:42571373 GenBank ACX17324.1 266 Sequence 44761 from patent US 7569389
GI:18390767 GenBank EFH65906.1 266 sterol 4-alpha-methyl-oxidase 2 [Arabidopsis lyrata subsp. lyrata]
GI:18390767 GenBank ESQ36159.1 266 hypothetical protein EUTSA_v10008485mg [Eutrema salsugineum]
GI:18390767 RefSeq XP_002889647.1 266 sterol 4-alpha-methyl-oxidase 2 [Arabidopsis lyrata subsp. lyrata]
GI:42571373 SwissProt Q8VWZ8.1 266 RecName: Full=Methylsterol monooxygenase 2-2; AltName: Full=Sterol 4-alpha-methyl-oxidase 1; Short=AtSMO1; AltName: Full=Sterol 4-alpha-methyl-oxidase 2-2 [Arabidopsis thaliana]