Gene/Proteome Database (LMPD)
Proteins
| N-acylphosphatidylethanolamine synthase | |
|---|---|
| Refseq ID | NP_177990 |
| Protein GI | 15219155 |
| UniProt ID | Q9ZV87 |
| mRNA ID | NM_106516 |
| Length | 284 |
| RefSeq Status | REVIEWED |
| MGKIMEWAARSDHLGGIPRNTVIMAVSAFAKAVANLCNKSSVHNADTLMNLVQSRPPGVPLITVSNHMSTLDDPVMWGAFKGLLSLDPELARWVLAAEDICFRNPIFSYIFRTGKCIPITRGGGIYQENMNEALQRLKDGSWLHTFPEGKVFQDDVPIRRLKWGTASLIARSPVTPIVLPIIHRGFEEMMPENYNNGRRPLVPLPNKHLKVVVGEPIEFDVPMMVETAVLDSRHVTPPLQEVKWPVLTSAGQVLDETAQRHLYIALSEKIQSSLETLRLLAKRL | |
Gene Information
Entrez Gene ID
Gene Name
N-acylphosphatidylethanolamine synthase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IDA:UniProtKB | C | plasma membrane |
| GO:0016746 | IDA:UniProtKB | F | transferase activity, transferring acyl groups |
| GO:0006650 | IDA:TAIR | P | glycerophospholipid metabolic process |
| GO:0008654 | IEA:UniProtKB-KW | P | phospholipid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath00564 | Glycerophospholipid metabolism |
| ko00564 | Glycerophospholipid metabolism |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
N-acylphosphatidylethanolamine synthase
Protein Entry
NAPES_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | In imbibed seeds, accumulates in cotyledons and hypocotyls. In flowers, expressed in the filament of stamens, in the style, and in ovary with eggs of pistil. {ECO:0000269|PubMed:19447891}. |
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine. {ECO:0000250}. |
| Function | Acyltransferase that catalyzes the N-acylation of phosphatidylethanolamine to form N-acylphosphatidylethanolamine (N-acyl-PE) (e.g. NAPEs containing C16:0, C16:1, C18:0, and C18:1). Mediates also the formation of acylphosphatidylglycerol (acyl-PG) from lysoglycerophospholipid by O-acylation. Uses acyl- CoA as acyl donors. Acylates 1-acyllysophosphatidylethanolamine (1-acyllyso-PE) and 1-acyllysophosphatidylglycerol (1-acyllyso-PG) at the sn-2-position. {ECO:0000269|PubMed:19447891, ECO:0000269|PubMed:21803774}. |
| Sequence Caution | Sequence=AAK76548.1; Type=Frameshift; Positions=143; Evidence={ECO:0000305}; |
| Similarity | Belongs to the taffazin family. {ECO:0000305}. |
| Subcellular Location | Cell membrane {ECO:0000269|PubMed:19447891}; Single-pass membrane protein {ECO:0000269|PubMed:19447891}. |
| Tissue Specificity | Essentially present in young tissues. Expressed in roots, cotyledons, leaves, and shoot and root apical meristems. {ECO:0000269|PubMed:19447891}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010643 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15219155 | RefSeq | NP_177990 | 284 | N-acylphosphatidylethanolamine synthase |
Identical Sequences to LMP010643 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15219155 | EMBL | CAH69767.1 | 284 | unnamed protein product [Arabidopsis thaliana] |
| GI:15219155 | GenBank | AAC83040.1 | 284 | Similar to gb|X92762 tafazzins protein from Homo sapiens [Arabidopsis thaliana] |
| GI:15219155 | GenBank | ADT60792.1 | 284 | Sequence 2474 from patent US 7847156 |
| GI:15219155 | GenBank | AEE36139.1 | 284 | N-acylphosphatidylethanolamine synthase [Arabidopsis thaliana] |
| GI:15219155 | SwissProt | Q9ZV87.1 | 284 | RecName: Full=N-acylphosphatidylethanolamine synthase; Short=NAPE synthase; AltName: Full=Lysoglycerophospholipid acyltransferase; AltName: Full=Monolysocardiolipin acyltransferase [Arabidopsis thaliana] |
Related Sequences to LMP010643 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15219155 | GenBank | EFH64012.1 | 284 | phospholipid/glycerol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15219155 | RefSeq | XP_002887753.1 | 284 | phospholipid/glycerol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:15219155 | RefSeq | XP_010417474.1 | 284 | PREDICTED: N-acylphosphatidylethanolamine synthase [Camelina sativa] |
| GI:15219155 | RefSeq | XP_010429698.1 | 284 | PREDICTED: N-acylphosphatidylethanolamine synthase-like [Camelina sativa] |
| GI:15219155 | RefSeq | XP_010472703.1 | 284 | PREDICTED: N-acylphosphatidylethanolamine synthase-like isoform X1 [Camelina sativa] |
| GI:15219155 | RefSeq | XP_010472704.1 | 284 | PREDICTED: N-acylphosphatidylethanolamine synthase-like isoform X2 [Camelina sativa] |