Gene/Proteome Database (LMPD)

LMPD ID
LMP010643
Gene ID
844205
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
N-acylphosphatidylethanolamine synthase
Gene Symbol
AT1G78690
Synonyms
F9K20.27; F9K20_27
Alternate Names
N-acylphosphatidylethanolamine synthase
Chromosome
1
EC Number
2.3.1.-

Proteins

N-acylphosphatidylethanolamine synthase
Refseq ID NP_177990
Protein GI 15219155
UniProt ID Q9ZV87
mRNA ID NM_106516
Length 284
RefSeq Status REVIEWED
MGKIMEWAARSDHLGGIPRNTVIMAVSAFAKAVANLCNKSSVHNADTLMNLVQSRPPGVPLITVSNHMSTLDDPVMWGAFKGLLSLDPELARWVLAAEDICFRNPIFSYIFRTGKCIPITRGGGIYQENMNEALQRLKDGSWLHTFPEGKVFQDDVPIRRLKWGTASLIARSPVTPIVLPIIHRGFEEMMPENYNNGRRPLVPLPNKHLKVVVGEPIEFDVPMMVETAVLDSRHVTPPLQEVKWPVLTSAGQVLDETAQRHLYIALSEKIQSSLETLRLLAKRL

Gene Information

Entrez Gene ID
844205
Gene Name
N-acylphosphatidylethanolamine synthase
Gene Symbol
AT1G78690
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0016746 IDA:UniProtKB F transferase activity, transferring acyl groups
GO:0006650 IDA:TAIR P glycerophospholipid metabolic process
GO:0008654 IEA:UniProtKB-KW P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00564 Glycerophospholipid metabolism
ko00564 Glycerophospholipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
6254313 Acyl chain remodeling of CL
6253801 Glycerophospholipid biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002123 Phospholipid/glycerol acyltransferase
IPR000872 Tafazzin

UniProt Annotations

Entry Information

Gene Name
N-acylphosphatidylethanolamine synthase
Protein Entry
NAPES_ARATH
UniProt ID
Q9ZV87
Species
Arabidopsis

Comments

Comment Type Description
Developmental Stage In imbibed seeds, accumulates in cotyledons and hypocotyls. In flowers, expressed in the filament of stamens, in the style, and in ovary with eggs of pistil. {ECO:0000269|PubMed:19447891}.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphocholine. {ECO:0000250}.
Function Acyltransferase that catalyzes the N-acylation of phosphatidylethanolamine to form N-acylphosphatidylethanolamine (N-acyl-PE) (e.g. NAPEs containing C16:0, C16:1, C18:0, and C18:1). Mediates also the formation of acylphosphatidylglycerol (acyl-PG) from lysoglycerophospholipid by O-acylation. Uses acyl- CoA as acyl donors. Acylates 1-acyllysophosphatidylethanolamine (1-acyllyso-PE) and 1-acyllysophosphatidylglycerol (1-acyllyso-PG) at the sn-2-position. {ECO:0000269|PubMed:19447891, ECO:0000269|PubMed:21803774}.
Sequence Caution Sequence=AAK76548.1; Type=Frameshift; Positions=143; Evidence={ECO:0000305};
Similarity Belongs to the taffazin family. {ECO:0000305}.
Subcellular Location Cell membrane {ECO:0000269|PubMed:19447891}; Single-pass membrane protein {ECO:0000269|PubMed:19447891}.
Tissue Specificity Essentially present in young tissues. Expressed in roots, cotyledons, leaves, and shoot and root apical meristems. {ECO:0000269|PubMed:19447891}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010643 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15219155 RefSeq NP_177990 284 N-acylphosphatidylethanolamine synthase

Identical Sequences to LMP010643 proteins

Reference Database Accession Length Protein Name
GI:15219155 EMBL CAH69767.1 284 unnamed protein product [Arabidopsis thaliana]
GI:15219155 GenBank AAC83040.1 284 Similar to gb|X92762 tafazzins protein from Homo sapiens [Arabidopsis thaliana]
GI:15219155 GenBank ADT60792.1 284 Sequence 2474 from patent US 7847156
GI:15219155 GenBank AEE36139.1 284 N-acylphosphatidylethanolamine synthase [Arabidopsis thaliana]
GI:15219155 SwissProt Q9ZV87.1 284 RecName: Full=N-acylphosphatidylethanolamine synthase; Short=NAPE synthase; AltName: Full=Lysoglycerophospholipid acyltransferase; AltName: Full=Monolysocardiolipin acyltransferase [Arabidopsis thaliana]

Related Sequences to LMP010643 proteins

Reference Database Accession Length Protein Name
GI:15219155 GenBank EFH64012.1 284 phospholipid/glycerol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15219155 RefSeq XP_002887753.1 284 phospholipid/glycerol acyltransferase family protein [Arabidopsis lyrata subsp. lyrata]
GI:15219155 RefSeq XP_010417474.1 284 PREDICTED: N-acylphosphatidylethanolamine synthase [Camelina sativa]
GI:15219155 RefSeq XP_010429698.1 284 PREDICTED: N-acylphosphatidylethanolamine synthase-like [Camelina sativa]
GI:15219155 RefSeq XP_010472703.1 284 PREDICTED: N-acylphosphatidylethanolamine synthase-like isoform X1 [Camelina sativa]
GI:15219155 RefSeq XP_010472704.1 284 PREDICTED: N-acylphosphatidylethanolamine synthase-like isoform X2 [Camelina sativa]