Gene/Proteome Database (LMPD)

LMPD ID
LMP010668
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Synonyms
T15F16.16; T15F16_16
Alternate Names
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Chromosome
4
Summary
Predicted to encode a PR (pathogenesis-related) protein. Belongs to the lipid transfer protein (PR-14) family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
Orthologs

Proteins

bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Refseq ID NP_192593
Protein GI 42566337
UniProt ID Q9M0T1
mRNA ID NM_116922
Length 103
RefSeq Status REVIEWED
MVTYPNGDRHCVMAQGQVISACLQQANGLPHADCCYAINDVNRYVETIYGRLALCKCFQEILKDSRFTKLIGMPEKCAIPNAVPFDPKTDCDRFVEHIWLKMF

Gene Information

Entrez Gene ID
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006810 IEA:UniProtKB-KW P transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain

UniProt Annotations

Entry Information

Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
NLTPF_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Sequence Caution Sequence=AAT85731.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AEE82654.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010668 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
42566337 RefSeq NP_192593 103 bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein

Identical Sequences to LMP010668 proteins

Reference Database Accession Length Protein Name
GI:42566337 GenBank AAT85731.1 103 At4g08530 [Arabidopsis thaliana]
GI:42566337 GenBank AAU15143.1 103 At4g08530 [Arabidopsis thaliana]
GI:42566337 GenBank AEE82654.1 103 bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana]
GI:42566337 GenBank AGV98062.1 103 Sequence 177 from patent US 8513488

Related Sequences to LMP010668 proteins

Reference Database Accession Length Protein Name
GI:42566337 EMBL CAB77978.1 126 putative lipid transfer protein [Arabidopsis thaliana]
GI:42566337 GenBank EFH48660.1 106 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:42566337 RefSeq XP_002872401.1 106 predicted protein [Arabidopsis lyrata subsp. lyrata]
GI:42566337 RefSeq XP_010435731.1 119 PREDICTED: non-specific lipid-transfer protein 15-like [Camelina sativa]
GI:42566337 RefSeq XP_010421771.1 120 PREDICTED: non-specific lipid-transfer protein 15-like [Camelina sativa]
GI:42566337 SwissProt Q9M0T1.1 126 RecName: Full=Non-specific lipid-transfer protein 15; Short=LTP 15; Flags: Precursor [Arabidopsis thaliana]