Gene/Proteome Database (LMPD)
LMPD ID
LMP010668
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Synonyms
T15F16.16; T15F16_16
Alternate Names
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Chromosome
4
Summary
Predicted to encode a PR (pathogenesis-related) protein. Belongs to the lipid transfer protein (PR-14) family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
Orthologs
Proteins
| bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
|---|---|
| Refseq ID | NP_192593 |
| Protein GI | 42566337 |
| UniProt ID | Q9M0T1 |
| mRNA ID | NM_116922 |
| Length | 103 |
| RefSeq Status | REVIEWED |
| MVTYPNGDRHCVMAQGQVISACLQQANGLPHADCCYAINDVNRYVETIYGRLALCKCFQEILKDSRFTKLIGMPEKCAIPNAVPFDPKTDCDRFVEHIWLKMF | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0006810 | IEA:UniProtKB-KW | P | transport |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
NLTPF_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Function | Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}. |
| Sequence Caution | Sequence=AAT85731.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; Sequence=AEE82654.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010668 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 42566337 | RefSeq | NP_192593 | 103 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
Identical Sequences to LMP010668 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42566337 | GenBank | AAT85731.1 | 103 | At4g08530 [Arabidopsis thaliana] |
| GI:42566337 | GenBank | AAU15143.1 | 103 | At4g08530 [Arabidopsis thaliana] |
| GI:42566337 | GenBank | AEE82654.1 | 103 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:42566337 | GenBank | AGV98062.1 | 103 | Sequence 177 from patent US 8513488 |
Related Sequences to LMP010668 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42566337 | EMBL | CAB77978.1 | 126 | putative lipid transfer protein [Arabidopsis thaliana] |
| GI:42566337 | GenBank | EFH48660.1 | 106 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:42566337 | RefSeq | XP_002872401.1 | 106 | predicted protein [Arabidopsis lyrata subsp. lyrata] |
| GI:42566337 | RefSeq | XP_010435731.1 | 119 | PREDICTED: non-specific lipid-transfer protein 15-like [Camelina sativa] |
| GI:42566337 | RefSeq | XP_010421771.1 | 120 | PREDICTED: non-specific lipid-transfer protein 15-like [Camelina sativa] |
| GI:42566337 | SwissProt | Q9M0T1.1 | 126 | RecName: Full=Non-specific lipid-transfer protein 15; Short=LTP 15; Flags: Precursor [Arabidopsis thaliana] |