Gene/Proteome Database (LMPD)

LMPD ID
LMP010672
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
pathogenesis-related protein LTP5
Gene Symbol
Synonyms
lipid transfer protein 5; LTP5; T18N14.5
Alternate Names
pathogenesis-related protein LTP5
Chromosome
3
Summary
Predicted to encode a PR (pathogenesis-related) protein. Belongs to the lipid transfer protein (PR-14) family with the following members: At2g38540/LTP1, At2g38530/LTP2, At5g59320/LTP3, At5g59310/LTP4, At3g51600/LTP5, At3g08770/LTP6, At2g15050/LTP7, At2g18370/LTP8, At2g15325/LTP9, At5g01870/LTP10, At4g33355/LTP11, At3g51590/LTP12, At5g44265/LTP13, At5g62065/LTP14, At4g08530/LTP15.
Orthologs

Proteins

pathogenesis-related protein LTP5
Refseq ID NP_190728
Protein GI 15230533
UniProt ID Q9XFS7
mRNA ID NM_115019
Length 118
RefSeq Status REVIEWED
MEGLLKLSTLVIVCMLVTAPMASEAAISCGAVTGSLGQCYNYLTRGGFIPRGCCSGVQRLNSLARTTRDRQQACRCIQGAARALGSRLNAGRAARLPGACRVRISYPISARTNCNTVR

Gene Information

Entrez Gene ID
Gene Name
pathogenesis-related protein LTP5
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005618 IDA:TAIR C cell wall
GO:0009506 IDA:TAIR C plasmodesma
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
pathogenesis-related protein LTP5
Protein Entry
NLTP5_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Sequence Caution Sequence=AAM66937.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010672 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15230533 RefSeq NP_190728 118 pathogenesis-related protein LTP5

Identical Sequences to LMP010672 proteins

Reference Database Accession Length Protein Name
GI:15230533 EMBL CAB63024.1 118 non-specific lipid transfer protein [Arabidopsis thaliana]
GI:15230533 GenBank AAF76931.1 118 lipid transfer protein 5 [Arabidopsis thaliana]
GI:15230533 GenBank AAL25528.1 118 AT3g51600/F26O13_240 [Arabidopsis thaliana]
GI:15230533 GenBank AAM16208.1 118 AT3g51600/F26O13_240 [Arabidopsis thaliana]
GI:15230533 GenBank AEE78811.1 118 pathogenesis-related protein LTP5 [Arabidopsis thaliana]
GI:15230533 SwissProt Q9XFS7.1 118 RecName: Full=Non-specific lipid-transfer protein 5; Short=LTP 5; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010672 proteins

Reference Database Accession Length Protein Name
GI:15230533 GenBank EFH54072.1 118 hypothetical protein ARALYDRAFT_485512 [Arabidopsis lyrata subsp. lyrata]
GI:15230533 GenBank EOA24960.1 118 hypothetical protein CARUB_v10018257mg [Capsella rubella]
GI:15230533 RefSeq XP_002877813.1 118 hypothetical protein ARALYDRAFT_485512 [Arabidopsis lyrata subsp. lyrata]
GI:15230533 RefSeq XP_010503855.1 118 PREDICTED: non-specific lipid-transfer protein 5-like [Camelina sativa]
GI:15230533 RefSeq XP_010515587.1 118 PREDICTED: non-specific lipid-transfer protein 5-like [Camelina sativa]
GI:15230533 RefSeq XP_010426733.1 118 PREDICTED: non-specific lipid-transfer protein 5 [Camelina sativa]