Gene/Proteome Database (LMPD)

LMPD ID
LMP010676
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
Non-specific lipid-transfer protein-like protein
Gene Symbol
Synonyms
F17L24.13; F17L24_13
Alternate Names
Non-specific lipid-transfer protein-like protein
Chromosome
2

Proteins

Non-specific lipid-transfer protein-like protein
Refseq ID NP_179002
Protein GI 15225509
UniProt ID Q9ZQI8
mRNA ID NM_126958
Length 169
RefSeq Status REVIEWED
MAYATILMIFSVVALMSGERAHAAVDCSSLILNMADCLSFVTSGSTVVKPEGTCCSGLKTVVRTGPECLCEAFKNSGSLGLTLDLSKAASLPSVCKVAAPPSARCGLSVSGDPPATAPGLSPTAGAGAPALSSGANAATPVSSPRSSDASLLSVSFAFVIFMALISSFY
Non-specific lipid-transfer protein-like protein
Refseq ID NP_973450
Protein GI 42570753
UniProt ID Q9ZQI8
mRNA ID NM_201721
Length 129
RefSeq Status REVIEWED
MAYATILMIFSVVALMSGERAHAAVDCSSLILNMADCLSFVTSGSTVVKPEGTCCSGLKTVVRTGPECLCEAFKNSGSLGLTLDLSKAASLPSVCKVAAPPSARCGLSVSGDPPATAPGMCYFILKSRD

Gene Information

Entrez Gene ID
Gene Name
Non-specific lipid-transfer protein-like protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0046658 IDA:TAIR C anchored component of plasma membrane
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0005886 IDA:TAIR C plasma membrane
GO:0008289 IEA:InterPro F lipid binding
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
Non-specific lipid-transfer protein-like protein
Protein Entry
NLTL2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9ZQI8-1; Sequence=Displayed; Name=2; IsoId=Q9ZQI8-2; Sequence=VSP_021392; Note=Derived from EST data. No experimental confirmation available. Has no GPI-anchor.;
Similarity Belongs to the plant LTP family. {ECO:0000305}.
Subcellular Location Isoform 1: Cell membrane; Lipid-anchor, GPI- anchor.
Subcellular Location Isoform 2: Secreted {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010676 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15225509 RefSeq NP_179002 169 Non-specific lipid-transfer protein-like protein
42570753 RefSeq NP_973450 129 Non-specific lipid-transfer protein-like protein

Identical Sequences to LMP010676 proteins

Reference Database Accession Length Protein Name
GI:15225509 GenBank AAM15251.1 169 putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana]
GI:15225509 GenBank AAM64422.1 169 putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana]
GI:15225509 GenBank AEC06262.1 169 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:42570753 GenBank AEC06263.1 129 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:15225509 gnl TIGR 169 putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana]
GI:15225509 SwissProt Q9ZQI8.1 169 RecName: Full=Non-specific lipid-transfer protein-like protein At2g13820; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010676 proteins

Reference Database Accession Length Protein Name
GI:15225509 DBBJ BAE99377.1 169 predicted GPI-anchored protein [Arabidopsis thaliana]
GI:42570753 GenBank AAM15251.1 169 putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana]
GI:42570753 GenBank AAM64422.1 169 putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana]
GI:15225509 GenBank AAO23627.1 169 At2g13820 [Arabidopsis thaliana]
GI:42570753 GenBank AEC06262.1 169 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:15225509 GenBank EOA31573.1 175 hypothetical protein CARUB_v10014766mg [Capsella rubella]
GI:42570753 gnl TIGR 169 putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana]
GI:42570753 RefSeq NP_179002.1 169 Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana]
GI:15225509 RefSeq XP_006298675.1 175 hypothetical protein CARUB_v10014766mg [Capsella rubella]
GI:15225509 RefSeq XP_010467208.1 170 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa]
GI:15225509 RefSeq XP_010488869.1 170 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa]
GI:42570753 SwissProt Q9ZQI8.1 169 RecName: Full=Non-specific lipid-transfer protein-like protein At2g13820; Flags: Precursor [Arabidopsis thaliana]