Gene/Proteome Database (LMPD)
Proteins
| Non-specific lipid-transfer protein-like protein | |
|---|---|
| Refseq ID | NP_179002 |
| Protein GI | 15225509 |
| UniProt ID | Q9ZQI8 |
| mRNA ID | NM_126958 |
| Length | 169 |
| RefSeq Status | REVIEWED |
| MAYATILMIFSVVALMSGERAHAAVDCSSLILNMADCLSFVTSGSTVVKPEGTCCSGLKTVVRTGPECLCEAFKNSGSLGLTLDLSKAASLPSVCKVAAPPSARCGLSVSGDPPATAPGLSPTAGAGAPALSSGANAATPVSSPRSSDASLLSVSFAFVIFMALISSFY | |
Gene Information
Entrez Gene ID
Gene Name
Non-specific lipid-transfer protein-like protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0046658 | IDA:TAIR | C | anchored component of plasma membrane |
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0005886 | IDA:TAIR | C | plasma membrane |
| GO:0008289 | IEA:InterPro | F | lipid binding |
| GO:0006869 | IEA:InterPro | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
Non-specific lipid-transfer protein-like protein
Protein Entry
NLTL2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9ZQI8-1; Sequence=Displayed; Name=2; IsoId=Q9ZQI8-2; Sequence=VSP_021392; Note=Derived from EST data. No experimental confirmation available. Has no GPI-anchor.; |
| Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
| Subcellular Location | Isoform 1: Cell membrane; Lipid-anchor, GPI- anchor. |
| Subcellular Location | Isoform 2: Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010676 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15225509 | RefSeq | NP_179002 | 169 | Non-specific lipid-transfer protein-like protein |
| 42570753 | RefSeq | NP_973450 | 129 | Non-specific lipid-transfer protein-like protein |
Identical Sequences to LMP010676 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15225509 | GenBank | AAM15251.1 | 169 | putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana] |
| GI:15225509 | GenBank | AAM64422.1 | 169 | putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana] |
| GI:15225509 | GenBank | AEC06262.1 | 169 | Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana] |
| GI:42570753 | GenBank | AEC06263.1 | 129 | Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana] |
| GI:15225509 | gnl | TIGR | 169 | putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana] |
| GI:15225509 | SwissProt | Q9ZQI8.1 | 169 | RecName: Full=Non-specific lipid-transfer protein-like protein At2g13820; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010676 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15225509 | DBBJ | BAE99377.1 | 169 | predicted GPI-anchored protein [Arabidopsis thaliana] |
| GI:42570753 | GenBank | AAM15251.1 | 169 | putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana] |
| GI:42570753 | GenBank | AAM64422.1 | 169 | putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana] |
| GI:15225509 | GenBank | AAO23627.1 | 169 | At2g13820 [Arabidopsis thaliana] |
| GI:42570753 | GenBank | AEC06262.1 | 169 | Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana] |
| GI:15225509 | GenBank | EOA31573.1 | 175 | hypothetical protein CARUB_v10014766mg [Capsella rubella] |
| GI:42570753 | gnl | TIGR | 169 | putative nonspecific lipid-transfer protein precursor [Arabidopsis thaliana] |
| GI:42570753 | RefSeq | NP_179002.1 | 169 | Non-specific lipid-transfer protein-like protein [Arabidopsis thaliana] |
| GI:15225509 | RefSeq | XP_006298675.1 | 175 | hypothetical protein CARUB_v10014766mg [Capsella rubella] |
| GI:15225509 | RefSeq | XP_010467208.1 | 170 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa] |
| GI:15225509 | RefSeq | XP_010488869.1 | 170 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Camelina sativa] |
| GI:42570753 | SwissProt | Q9ZQI8.1 | 169 | RecName: Full=Non-specific lipid-transfer protein-like protein At2g13820; Flags: Precursor [Arabidopsis thaliana] |