Gene/Proteome Database (LMPD)

LMPD ID
LMP010690
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
O-acyltransferase (WSD1-like) family protein
Gene Symbol
Chromosome
5

Proteins

O-acyltransferase (WSD1-like) family protein
Refseq ID NP_568275
Protein GI 18416859
UniProt ID Q94CK0
mRNA ID NM_121280
Length 480
RefSeq Status REVIEWED
MTYGEEEPVSPMARVFQSPGIDLCAVTIMGFKTKINPDVVLDALKQNVSKHPRFSSILSDNGAKWIETEVNVEDHVIVPYIDAEEIGEGGQSFIDDYMSRLTMIPLDRSRPLWDIHILNVKTSEAEAVGFIRSHHSLGDGMSLISLMLACTHKTSDPDMFSNAIPSMKRRATMSHSLKTKGWFLRSIFTIGSTMRLLWNTTIDMLLLLATVLFLKDTKTPLKAGADVRSNPKRFYHRIISLDDIKLIKNAMNMTINDVLFGITQASLSHYLNRQYGTKKEEDGALTSYRNNLPDGIRFRVACTVNLRSDIGFKPLADMMVKDSKCRWGNYFSFIFLPFTIGLQTDPLVYLKMSKSMMARKKHSYHAALVYFIIKIVLKVFGAKAAAELFDRPVRNTTTCVSNVIGPMEEISFRGHPVSYIAPSSYGHSHALLIHLMSYADKMIISLAYDPTVISDPHKICDDMEESLKAMKASLCERGLL

Gene Information

Entrez Gene ID
Gene Name
O-acyltransferase (WSD1-like) family protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004144 IEA:InterPro F diacylglycerol O-acyltransferase activity
GO:0045017 IEA:InterPro P glycerolipid biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR009721 O-acyltransferase, WSD1, C-terminal
IPR004255 O-acyltransferase, WSD1, N-terminal

UniProt Annotations

Entry Information

Gene Name
O-acyltransferase (WSD1-like) family protein
Protein Entry
Q94CK0_ARATH
UniProt ID
Species
Arabidopsis

Identical and Related Proteins

Unique RefSeq proteins for LMP010690 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18416859 RefSeq NP_568275 480 O-acyltransferase (WSD1-like) family protein

Identical Sequences to LMP010690 proteins

Reference Database Accession Length Protein Name
GI:18416859 DBBJ BAC42150.1 480 unknown protein [Arabidopsis thaliana]
GI:18416859 EMBL CAC42903.1 480 putative protein [Arabidopsis thaliana]
GI:18416859 GenBank AAL87279.1 480 unknown protein [Arabidopsis thaliana]
GI:18416859 GenBank AAM45124.1 480 unknown protein [Arabidopsis thaliana]
GI:18416859 GenBank ACW85406.1 480 Sequence 1353 from patent US 7569389
GI:18416859 gnl TAIR 480 O-acyltransferase (WSD1-like) family protein [Arabidopsis thaliana]

Related Sequences to LMP010690 proteins

Reference Database Accession Length Protein Name
GI:18416859 GenBank ACW85405.1 488 Sequence 1352 from patent US 7569389
GI:18416859 GenBank ACW85407.1 469 Sequence 1354 from patent US 7569389
GI:18416859 GenBank EFH49829.1 480 hypothetical protein ARALYDRAFT_488089 [Arabidopsis lyrata subsp. lyrata]
GI:18416859 GenBank EOA20501.1 492 hypothetical protein CARUB_v10000814mg [Capsella rubella]
GI:18416859 RefSeq XP_002873570.1 480 hypothetical protein ARALYDRAFT_488089 [Arabidopsis lyrata subsp. lyrata]
GI:18416859 RefSeq XP_006287603.1 492 hypothetical protein CARUB_v10000814mg [Capsella rubella]