Gene/Proteome Database (LMPD)
LMPD ID
LMP010773
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphatidate cytidylyltransferase
Gene Symbol
Synonyms
ATCDS1; CDP-diacylglycerol synthase 1; CDS1; F24O1.17; F24O1_17
Alternate Names
phosphatidate cytidylyltransferase
Chromosome
1
EC Number
2.7.7.41
Summary
Encodes a CDP-diacylglycerol synthase, involved in phospholipid biosynthesis.
Orthologs
Proteins
phosphatidate cytidylyltransferase | |
---|---|
Refseq ID | NP_176433 |
Protein GI | 30696710 |
UniProt ID | O04928 |
mRNA ID | NM_104923 |
Length | 421 |
RefSeq Status | REVIEWED |
MEEENVTSSPSTPVHRLRHRRRSNEVVTDGDKVNASPLLVNDRNKYKSFMVRTYSTLWMIGGFVLVVYMGHLYITAMVVVIQIFMAKELFNLLRKAPEDKCLPYIKQLNWHFFFTAMLFVYGRILSQRLANTMTADQFFYRLVSGLIKYHMAICYLLYIIGFMWFILTLKKKMYKYQFGQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIIINDIFAYIFGFFFGRTPLIKLSPKKTWEGFIGASVTTIISAFVLANILGRFPWLTCPRQDLSTGWLQCDADPLFKPEPFALPAWIPEWFPWKEMTILPVQWHALCLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYLQSFIVSQSVSVDKILDQILTNLTFEEQQALFVKLGQMLKDKLS |
Gene Information
Entrez Gene ID
Gene Name
phosphatidate cytidylyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016020 | ISS:TAIR | C | membrane |
GO:0004605 | IDA:TAIR | F | phosphatidate cytidylyltransferase activity |
GO:0016024 | IEA:UniProtKB-UniPathway | P | CDP-diacylglycerol biosynthetic process |
GO:0080186 | IGI:TAIR | P | developmental vegetative growth |
GO:0008654 | TAS:TAIR | P | phospholipid biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidate cytidylyltransferase
Protein Entry
CDS1_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | CTP + phosphatidate = diphosphate + CDP- diacylglycerol. |
Function | May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction. |
Pathway | Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3. |
Similarity | Belongs to the CDS family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010773 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
30696710 | RefSeq | NP_176433 | 421 | phosphatidate cytidylyltransferase |
Identical Sequences to LMP010773 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30696710 | EMBL | CBU87943.1 | 421 | unnamed protein product [Arabidopsis thaliana] |
GI:30696710 | EMBL | CBU94055.1 | 421 | unnamed protein product [Arabidopsis thaliana] |
GI:30696710 | GenBank | AEE33967.1 | 421 | phosphatidate cytidylyltransferase [Arabidopsis thaliana] |
GI:30696710 | GenBank | AGX54879.1 | 421 | Sequence 10116 from patent US 8541208 |
GI:30696710 | GenBank | AGX61353.1 | 421 | Sequence 22888 from patent US 8541208 |
GI:30696710 | GenBank | AGX95014.1 | 421 | Sequence 70291 from patent US 8541208 |
Related Sequences to LMP010773 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30696710 | GenBank | EFH62728.1 | 421 | CDP-diacylglycerol synthase 1 [Arabidopsis lyrata subsp. lyrata] |
GI:30696710 | GenBank | EOA35205.1 | 421 | hypothetical protein CARUB_v10020355mg [Capsella rubella] |
GI:30696710 | GenBank | ESQ29154.1 | 426 | hypothetical protein EUTSA_v10023471mg [Eutrema salsugineum] |
GI:30696710 | RefSeq | XP_002886469.1 | 421 | CDP-diacylglycerol synthase 1 [Arabidopsis lyrata subsp. lyrata] |
GI:30696710 | RefSeq | XP_006302307.1 | 421 | hypothetical protein CARUB_v10020355mg [Capsella rubella] |
GI:30696710 | RefSeq | XP_006391868.1 | 426 | hypothetical protein EUTSA_v10023471mg [Eutrema salsugineum] |