Gene/Proteome Database (LMPD)
LMPD ID
LMP010773
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphatidate cytidylyltransferase
Gene Symbol
Synonyms
ATCDS1; CDP-diacylglycerol synthase 1; CDS1; F24O1.17; F24O1_17
Alternate Names
phosphatidate cytidylyltransferase
Chromosome
1
EC Number
2.7.7.41
Summary
Encodes a CDP-diacylglycerol synthase, involved in phospholipid biosynthesis.
Orthologs
Proteins
| phosphatidate cytidylyltransferase | |
|---|---|
| Refseq ID | NP_176433 |
| Protein GI | 30696710 |
| UniProt ID | O04928 |
| mRNA ID | NM_104923 |
| Length | 421 |
| RefSeq Status | REVIEWED |
| MEEENVTSSPSTPVHRLRHRRRSNEVVTDGDKVNASPLLVNDRNKYKSFMVRTYSTLWMIGGFVLVVYMGHLYITAMVVVIQIFMAKELFNLLRKAPEDKCLPYIKQLNWHFFFTAMLFVYGRILSQRLANTMTADQFFYRLVSGLIKYHMAICYLLYIIGFMWFILTLKKKMYKYQFGQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIIINDIFAYIFGFFFGRTPLIKLSPKKTWEGFIGASVTTIISAFVLANILGRFPWLTCPRQDLSTGWLQCDADPLFKPEPFALPAWIPEWFPWKEMTILPVQWHALCLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYLQSFIVSQSVSVDKILDQILTNLTFEEQQALFVKLGQMLKDKLS | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidate cytidylyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | ISS:TAIR | C | membrane |
| GO:0004605 | IDA:TAIR | F | phosphatidate cytidylyltransferase activity |
| GO:0016024 | IEA:UniProtKB-UniPathway | P | CDP-diacylglycerol biosynthetic process |
| GO:0080186 | IGI:TAIR | P | developmental vegetative growth |
| GO:0008654 | TAS:TAIR | P | phospholipid biosynthetic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidate cytidylyltransferase
Protein Entry
CDS1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | CTP + phosphatidate = diphosphate + CDP- diacylglycerol. |
| Function | May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction. |
| Pathway | Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3. |
| Similarity | Belongs to the CDS family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010773 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 30696710 | RefSeq | NP_176433 | 421 | phosphatidate cytidylyltransferase |
Identical Sequences to LMP010773 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30696710 | EMBL | CBU87943.1 | 421 | unnamed protein product [Arabidopsis thaliana] |
| GI:30696710 | EMBL | CBU94055.1 | 421 | unnamed protein product [Arabidopsis thaliana] |
| GI:30696710 | GenBank | AEE33967.1 | 421 | phosphatidate cytidylyltransferase [Arabidopsis thaliana] |
| GI:30696710 | GenBank | AGX54879.1 | 421 | Sequence 10116 from patent US 8541208 |
| GI:30696710 | GenBank | AGX61353.1 | 421 | Sequence 22888 from patent US 8541208 |
| GI:30696710 | GenBank | AGX95014.1 | 421 | Sequence 70291 from patent US 8541208 |
Related Sequences to LMP010773 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30696710 | GenBank | EFH62728.1 | 421 | CDP-diacylglycerol synthase 1 [Arabidopsis lyrata subsp. lyrata] |
| GI:30696710 | GenBank | EOA35205.1 | 421 | hypothetical protein CARUB_v10020355mg [Capsella rubella] |
| GI:30696710 | GenBank | ESQ29154.1 | 426 | hypothetical protein EUTSA_v10023471mg [Eutrema salsugineum] |
| GI:30696710 | RefSeq | XP_002886469.1 | 421 | CDP-diacylglycerol synthase 1 [Arabidopsis lyrata subsp. lyrata] |
| GI:30696710 | RefSeq | XP_006302307.1 | 421 | hypothetical protein CARUB_v10020355mg [Capsella rubella] |
| GI:30696710 | RefSeq | XP_006391868.1 | 426 | hypothetical protein EUTSA_v10023471mg [Eutrema salsugineum] |