Gene/Proteome Database (LMPD)

LMPD ID
LMP010773
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
phosphatidate cytidylyltransferase
Gene Symbol
Synonyms
ATCDS1; CDP-diacylglycerol synthase 1; CDS1; F24O1.17; F24O1_17
Alternate Names
phosphatidate cytidylyltransferase
Chromosome
1
EC Number
2.7.7.41
Summary
Encodes a CDP-diacylglycerol synthase, involved in phospholipid biosynthesis.
Orthologs

Proteins

phosphatidate cytidylyltransferase
Refseq ID NP_176433
Protein GI 30696710
UniProt ID O04928
mRNA ID NM_104923
Length 421
RefSeq Status REVIEWED
MEEENVTSSPSTPVHRLRHRRRSNEVVTDGDKVNASPLLVNDRNKYKSFMVRTYSTLWMIGGFVLVVYMGHLYITAMVVVIQIFMAKELFNLLRKAPEDKCLPYIKQLNWHFFFTAMLFVYGRILSQRLANTMTADQFFYRLVSGLIKYHMAICYLLYIIGFMWFILTLKKKMYKYQFGQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIIINDIFAYIFGFFFGRTPLIKLSPKKTWEGFIGASVTTIISAFVLANILGRFPWLTCPRQDLSTGWLQCDADPLFKPEPFALPAWIPEWFPWKEMTILPVQWHALCLGLFASIIAPFGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYLQSFIVSQSVSVDKILDQILTNLTFEEQQALFVKLGQMLKDKLS

Gene Information

Entrez Gene ID
Gene Name
phosphatidate cytidylyltransferase
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:TAIR C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 ISS:TAIR C membrane
GO:0004605 IDA:TAIR F phosphatidate cytidylyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process
GO:0080186 IGI:TAIR P developmental vegetative growth
GO:0008654 TAS:TAIR P phospholipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath00564 Glycerophospholipid metabolism
ath01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
6254320 Synthesis of PG
6254315 Synthesis of PI

Domain Information

InterPro Annotations

Accession Description
IPR000374 Phosphatidate cytidylyltransferase
IPR016720 Phosphatidate cytidylyltransferase, eukaryota

UniProt Annotations

Entry Information

Gene Name
phosphatidate cytidylyltransferase
Protein Entry
CDS1_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity CTP + phosphatidate = diphosphate + CDP- diacylglycerol.
Function May be involved in the synthesis of minor phospholipids and in modulation of IP3-mediated signal transduction.
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 3/3.
Similarity Belongs to the CDS family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010773 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30696710 RefSeq NP_176433 421 phosphatidate cytidylyltransferase

Identical Sequences to LMP010773 proteins

Reference Database Accession Length Protein Name
GI:30696710 EMBL CBU87943.1 421 unnamed protein product [Arabidopsis thaliana]
GI:30696710 EMBL CBU94055.1 421 unnamed protein product [Arabidopsis thaliana]
GI:30696710 GenBank AEE33967.1 421 phosphatidate cytidylyltransferase [Arabidopsis thaliana]
GI:30696710 GenBank AGX54879.1 421 Sequence 10116 from patent US 8541208
GI:30696710 GenBank AGX61353.1 421 Sequence 22888 from patent US 8541208
GI:30696710 GenBank AGX95014.1 421 Sequence 70291 from patent US 8541208

Related Sequences to LMP010773 proteins

Reference Database Accession Length Protein Name
GI:30696710 GenBank EFH62728.1 421 CDP-diacylglycerol synthase 1 [Arabidopsis lyrata subsp. lyrata]
GI:30696710 GenBank EOA35205.1 421 hypothetical protein CARUB_v10020355mg [Capsella rubella]
GI:30696710 GenBank ESQ29154.1 426 hypothetical protein EUTSA_v10023471mg [Eutrema salsugineum]
GI:30696710 RefSeq XP_002886469.1 421 CDP-diacylglycerol synthase 1 [Arabidopsis lyrata subsp. lyrata]
GI:30696710 RefSeq XP_006302307.1 421 hypothetical protein CARUB_v10020355mg [Capsella rubella]
GI:30696710 RefSeq XP_006391868.1 426 hypothetical protein EUTSA_v10023471mg [Eutrema salsugineum]