Gene/Proteome Database (LMPD)
Proteins
| ubiquitin-like protein | |
|---|---|
| Refseq ID | NP_176628 |
| Protein GI | 15217656 |
| UniProt ID | Q9SGW8 |
| mRNA ID | NM_105122 |
| Length | 213 |
| RefSeq Status | REVIEWED |
| MSVADVALSPIHRGSAFAVGGFGQSTTTHYSVKSVLVFLSVSGSTMPMLILESDSIAEVKLRIQTCNGFRVRRQKLVFSGRELARNASRVKDYGVTGGSVLHLVLKLYDPLLVTVITTCGKVFQFHVDRRRNVGYLKKRISKEGKGFPEVDDQEILFKGEKLDDNRIIDGICKDGNSVIHLLVKKSVEDTVKREEDTATGKDSLLEPLFLTPM | |
Gene Information
Entrez Gene ID
Gene Name
ubiquitin-like protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0004430 | IEA:UniProtKB-EC | F | 1-phosphatidylinositol 4-kinase activity |
| GO:0009651 | IDA:UniProtKB | P | response to salt stress |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate. |
| Function | The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). {ECO:0000250}. |
| Induction | By salt. {ECO:0000269|PubMed:23323832}. |
| Sequence Caution | Sequence=AAF19692.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=AAF19692.1; Type=Frameshift; Positions=208; Evidence={ECO:0000305}; Sequence=AAS76698.1; Type=Frameshift; Positions=208; Evidence={ECO:0000305}; Sequence=AAS88785.1; Type=Frameshift; Positions=208; Evidence={ECO:0000305}; Sequence=AEE34243.1; Type=Erroneous gene model prediction; Note=Was originally thought to correspond to two different genes At1g64460 and At1g64470.; Evidence={ECO:0000305}; Sequence=AEE34244.1; Type=Erroneous gene model prediction; Note=Was originally thought to correspond to two different genes At1g64460 and At1g64470.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily. {ECO:0000305}. |
| Similarity | Contains 1 PI3K/PI4K domain. {ECO:0000305}. |
| Similarity | Contains 2 ubiquitin-like domains. {ECO:0000255|PROSITE-ProRule:PRU00214}. |
| Subcellular Location | Membrane {ECO:0000269|PubMed:23323832}; Peripheral membrane protein {ECO:0000269|PubMed:23323832}; Cytoplasmic side {ECO:0000269|PubMed:23323832}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010791 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15217656 | RefSeq | NP_176628 | 213 | ubiquitin-like protein |
Identical Sequences to LMP010791 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15217656 | GenBank | AAS76698.1 | 213 | At1g64470 [Arabidopsis thaliana] |
| GI:15217656 | GenBank | AAS88785.1 | 213 | At1g64470 [Arabidopsis thaliana] |
| GI:15217656 | GenBank | AEE34244.1 | 213 | ubiquitin-like protein [Arabidopsis thaliana] |
Related Sequences to LMP010791 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15217656 | EMBL | CBD07277.1 | 505 | unnamed protein product [Arabidopsis thaliana] |
| GI:15217656 | EMBL | CBD12348.1 | 505 | unnamed protein product [Arabidopsis thaliana] |
| GI:15217656 | EMBL | CBD14512.1 | 505 | unnamed protein product [Arabidopsis thaliana] |
| GI:15217656 | EMBL | CBD02220.1 | 505 | unnamed protein product [Arabidopsis thaliana] |
| GI:15217656 | GenBank | ACW89146.1 | 548 | Sequence 6463 from patent US 7569389 |
| GI:15217656 | SwissProt | Q9SGW8.2 | 550 | RecName: Full=Phosphatidylinositol 4-kinase gamma 2; Short=AtPI4Kgamma2; Short=PI-4Kgamma2; Short=PI4K gamma 2 [Arabidopsis thaliana] |