Gene/Proteome Database (LMPD)
LMPD ID
LMP010823
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
inositol phosphorylceramide synthase 3
Gene Symbol
Synonyms
Arabidopsis Inositol phosphorylceramide synthase 3; AtIPCS3
Alternate Names
inositol phosphorylceramide synthase 3
Chromosome
2
EC Number
2.7.8.-
Summary
Inositol phosphorylceramide synthase
Orthologs
Proteins
| inositol phosphorylceramide synthase 3 | |
|---|---|
| Refseq ID | NP_001189633 |
| Protein GI | 334184565 |
| UniProt ID | Q56Y01 |
| mRNA ID | NM_001202704 |
| Length | 289 |
| RefSeq Status | REVIEWED |
| MPVYVDREAPKLWRRIYSEATLEASLLAEKWKLVLAGLVFQYIHGLAAHGVHYLHRPGPTLQDAGFFILPALGQDKAFFSETVFVTIFGSFILWTFHPFVSHSKKICTVLIWCRVFVYLAASQSLRIITFFATQLPGPNYHCREGSKLAKIPPPKNVLEVLLINFPDGVIYGCGDLIFSSHTIFTLVFVRTYQRYGTRRWIKHLAWLMAVIQSILIIASRKHYTVDIVVAWYTVNLVMFYVDSKLPEMAERSSGPSPTPLLPLSTKDSKNKSKEDHQRLLNENNVADDH | |
| inositol phosphorylceramide synthase 3 | |
|---|---|
| Refseq ID | NP_850134 |
| Protein GI | 42570331 |
| UniProt ID | Q56Y01 |
| mRNA ID | NM_179803 |
| Length | 289 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:334184565 (mRNA isoform) | |
| inositol phosphorylceramide synthase 3 | |
|---|---|
| Refseq ID | NP_973560 |
| Protein GI | 42570973 |
| UniProt ID | Q56Y01 |
| mRNA ID | NM_201831 |
| Length | 251 |
| RefSeq Status | REVIEWED |
| MPVYVDREAPKLWRRIYSEATLEASLLAEKWKLVLAGLVFQYIHGLAAHGVHYLHRPGPTLQDAGFFILPALGQDKAFFSETVFVTIFGSFILWTFHPFVSHSKKICTVLIWCRVFVYLAASQSLRIITFFATQLPGPNYHCREGSKLAKIPPPKNVLEVLLINFPDGVIYGCGDLIFSSHTIFTLVFVRTYQRYGTRRWIKHLAWLMAVIQSILIIASRKHYTVDIVVAWYTVNLVMFYVDSKLPGKLAQ | |
Gene Information
Entrez Gene ID
Gene Name
inositol phosphorylceramide synthase 3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0045140 | IDA:TAIR | F | inositol phosphoceramide synthase activity |
| GO:0030148 | IDA:TAIR | P | sphingolipid biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-5129 | sphingolipid biosynthesis (plants) |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR025749 | Sphingomyelin synthase-like domain |
UniProt Annotations
Entry Information
Gene Name
inositol phosphorylceramide synthase 3
Protein Entry
IPCS3_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q56Y01-1; Sequence=Displayed; Name=2; IsoId=Q56Y01-2; Sequence=VSP_044382, VSP_044383; Note=No experimental confirmation available.; Name=3; IsoId=Q56Y01-3; Sequence=VSP_044380, VSP_044381; Note=No experimental confirmation available.; |
| Function | Catalyzes the transfer of the phosphorylinositol group from phosphatidylinositol (PI) to phytoceramide, an essential step in sphingolipid biosynthesis. {ECO:0000269|PubMed:20309609}. |
| Sequence Caution | Sequence=BX820662; Type=Frameshift; Positions=9; Evidence={ECO:0000305}; |
| Similarity | Belongs to the sphingomyelin synthase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Mostly expressed in stems and flowers, and, to a lower extent, in leaves, roots and siliques. {ECO:0000269|PubMed:20309609}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010823 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 334184565 | RefSeq | NP_001189633 | 289 | inositol phosphorylceramide synthase 3 |
| 42570973 | RefSeq | NP_973560 | 251 | inositol phosphorylceramide synthase 3 |
Identical Sequences to LMP010823 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:334184565 | EMBL | CBD12191.1 | 289 | unnamed protein product [Arabidopsis thaliana] |
| GI:334184565 | EMBL | CBC95355.1 | 289 | unnamed protein product [Arabidopsis thaliana] |
| GI:334184565 | EMBL | CBD02146.1 | 289 | unnamed protein product [Arabidopsis thaliana] |
| GI:334184565 | EMBL | CBC92960.1 | 289 | unnamed protein product [Arabidopsis thaliana] |
| GI:42570973 | GenBank | AEC08263.1 | 251 | inositol phosphorylceramide synthase 3 [Arabidopsis thaliana] |
| GI:334184565 | GenBank | AEC08264.1 | 289 | inositol phosphorylceramide synthase 3 [Arabidopsis thaliana] |
| GI:334184565 | GenBank | AEC08265.1 | 289 | inositol phosphorylceramide synthase 3 [Arabidopsis thaliana] |
Related Sequences to LMP010823 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42570973 | EMBL | CBC95355.1 | 289 | unnamed protein product [Arabidopsis thaliana] |
| GI:42570973 | EMBL | CBD02146.1 | 289 | unnamed protein product [Arabidopsis thaliana] |
| GI:42570973 | EMBL | CBC92960.1 | 289 | unnamed protein product [Arabidopsis thaliana] |
| GI:334184565 | GenBank | EFH55475.1 | 288 | hypothetical protein ARALYDRAFT_481869 [Arabidopsis lyrata subsp. lyrata] |
| GI:42570973 | GenBank | AEC08265.1 | 289 | inositol phosphorylceramide synthase 3 [Arabidopsis thaliana] |
| GI:334184565 | GenBank | EOA27624.1 | 289 | hypothetical protein CARUB_v10023772mg [Capsella rubella] |
| GI:42570973 | RefSeq | NP_850134.2 | 289 | inositol phosphorylceramide synthase 3 [Arabidopsis thaliana] |
| GI:334184565 | RefSeq | XP_002879216.1 | 288 | hypothetical protein ARALYDRAFT_481869 [Arabidopsis lyrata subsp. lyrata] |
| GI:42570973 | RefSeq | NP_001189633.1 | 289 | inositol phosphorylceramide synthase 3 [Arabidopsis thaliana] |
| GI:334184565 | RefSeq | XP_006294726.1 | 289 | hypothetical protein CARUB_v10023772mg [Capsella rubella] |
| GI:334184565 | RefSeq | XP_010414368.1 | 289 | PREDICTED: phosphatidylinositol:ceramide inositolphosphotransferase 3 [Camelina sativa] |
| GI:334184565 | RefSeq | XP_010469944.1 | 289 | PREDICTED: phosphatidylinositol:ceramide inositolphosphotransferase 3-like isoform X1 [Camelina sativa] |