Gene/Proteome Database (LMPD)
LMPD ID
LMP010916
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glucan endo-1,3-beta-glucosidase-like protein 3
Gene Symbol
Synonyms
3-beta-glucosidase-like protein 3; E13L3; F13G24.200; F13G24_200; glucan endo-1; PDCB2; PLASMODESMATA CALLOSE-BINDING PROTEIN 2
Alternate Names
glucan endo-1,3-beta-glucosidase-like protein 3
Chromosome
5
Proteins
| glucan endo-1,3-beta-glucosidase-like protein 3 | |
|---|---|
| Refseq ID | NP_196417 |
| Protein GI | 15241485 |
| UniProt ID | Q9SD84 |
| mRNA ID | NM_120882 |
| Length | 194 |
| RefSeq Status | REVIEWED |
| MAPLVLYLLTLLMAGHTSASWCVCKTGLSDSVLQKTLDYACGNGADCNPTHPKGSCFNPDNVRAHCNYAVNSFFQKKGQASESCNFTGTATLTTTDPSYTGCAFPSSASGSSGSGSTTVTPGKNSPKGSNSITTFPGGNSPYSGTPSTGLLGGNITDATGTGLNPDYSTESSGFALYYSNNLLLTGFCSLVMML | |
Gene Information
Entrez Gene ID
Gene Name
glucan endo-1,3-beta-glucosidase-like protein 3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031225 | TAS:TAIR | C | anchored component of membrane |
| GO:0046658 | IDA:TAIR | C | anchored component of plasma membrane |
| GO:0009506 | IDA:TAIR | C | plasmodesma |
| GO:0001872 | IDA:TAIR | F | (1->3)-beta-D-glucan binding |
| GO:0030247 | IDA:TAIR | F | polysaccharide binding |
| GO:0009408 | IEP:UniProtKB | P | response to heat |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR012946 | X8 domain |
UniProt Annotations
Entry Information
Gene Name
glucan endo-1,3-beta-glucosidase-like protein 3
Protein Entry
PDCB2_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Function | Able to bind (1->3)-beta-D-glucans (laminarin). {ECO:0000269|PubMed:19223515}. |
| Induction | Down-regulated by heat treatment. {ECO:0000269|PubMed:19223515}. |
| Ptm | Contains two additional disulfide bonds. {ECO:0000250}. |
| Subcellular Location | Cell membrane {ECO:0000269|PubMed:19223515}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:19223515}. Cell junction, plasmodesma {ECO:0000269|PubMed:19223515}. |
| Tissue Specificity | Expressed in the shoot apical region and in young leaves but also detected in the laminar and vasculature of mature leaves. {ECO:0000269|PubMed:19223515}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010916 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15241485 | RefSeq | NP_196417 | 194 | glucan endo-1,3-beta-glucosidase-like protein 3 |
Identical Sequences to LMP010916 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15241485 | DBBJ | BAC43178.1 | 194 | GPI-anchored protein [Arabidopsis thaliana] |
| GI:15241485 | GenBank | AAO39944.1 | 194 | At5g08000 [Arabidopsis thaliana] |
| GI:15241485 | GenBank | AFX49223.1 | 194 | Sequence 51056 from patent US 8299318 |
| GI:15241485 | GenBank | AGF14317.1 | 194 | Sequence 13736 from patent US 8362325 |
| GI:15241485 | gnl | TAIR | 194 | glucan endo-1,3-beta-glucosidase-like protein 3 [Arabidopsis thaliana] |
| GI:15241485 | SwissProt | Q9SD84.1 | 194 | RecName: Full=PLASMODESMATA CALLOSE-BINDING PROTEIN 2; Short=AtPDCB2; AltName: Full=Glucan endo-1,3-beta-glucosidase-like protein 3; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP010916 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15241485 | GenBank | AAM64809.1 | 194 | unknown [Arabidopsis thaliana] |
| GI:15241485 | GenBank | EFH47558.1 | 194 | hypothetical protein ARALYDRAFT_350051 [Arabidopsis lyrata subsp. lyrata] |
| GI:15241485 | GenBank | EOA21598.1 | 197 | hypothetical protein CARUB_v10002008mg [Capsella rubella] |
| GI:15241485 | RefSeq | XP_002871299.1 | 194 | hypothetical protein ARALYDRAFT_350051 [Arabidopsis lyrata subsp. lyrata] |
| GI:15241485 | RefSeq | XP_006288700.1 | 197 | hypothetical protein CARUB_v10002008mg [Capsella rubella] |
| GI:15241485 | RefSeq | XP_010452771.1 | 196 | PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 2 [Camelina sativa] |