Gene/Proteome Database (LMPD)

LMPD ID
LMP010916
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glucan endo-1,3-beta-glucosidase-like protein 3
Gene Symbol
Synonyms
3-beta-glucosidase-like protein 3; E13L3; F13G24.200; F13G24_200; glucan endo-1; PDCB2; PLASMODESMATA CALLOSE-BINDING PROTEIN 2
Alternate Names
glucan endo-1,3-beta-glucosidase-like protein 3
Chromosome
5

Proteins

glucan endo-1,3-beta-glucosidase-like protein 3
Refseq ID NP_196417
Protein GI 15241485
UniProt ID Q9SD84
mRNA ID NM_120882
Length 194
RefSeq Status REVIEWED
MAPLVLYLLTLLMAGHTSASWCVCKTGLSDSVLQKTLDYACGNGADCNPTHPKGSCFNPDNVRAHCNYAVNSFFQKKGQASESCNFTGTATLTTTDPSYTGCAFPSSASGSSGSGSTTVTPGKNSPKGSNSITTFPGGNSPYSGTPSTGLLGGNITDATGTGLNPDYSTESSGFALYYSNNLLLTGFCSLVMML

Gene Information

Entrez Gene ID
Gene Name
glucan endo-1,3-beta-glucosidase-like protein 3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 TAS:TAIR C anchored component of membrane
GO:0046658 IDA:TAIR C anchored component of plasma membrane
GO:0009506 IDA:TAIR C plasmodesma
GO:0001872 IDA:TAIR F (1->3)-beta-D-glucan binding
GO:0030247 IDA:TAIR F polysaccharide binding
GO:0009408 IEP:UniProtKB P response to heat

Domain Information

InterPro Annotations

Accession Description
IPR012946 X8 domain

UniProt Annotations

Entry Information

Gene Name
glucan endo-1,3-beta-glucosidase-like protein 3
Protein Entry
PDCB2_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Able to bind (1->3)-beta-D-glucans (laminarin). {ECO:0000269|PubMed:19223515}.
Induction Down-regulated by heat treatment. {ECO:0000269|PubMed:19223515}.
Ptm Contains two additional disulfide bonds. {ECO:0000250}.
Subcellular Location Cell membrane {ECO:0000269|PubMed:19223515}; Lipid-anchor, GPI-anchor {ECO:0000269|PubMed:19223515}. Cell junction, plasmodesma {ECO:0000269|PubMed:19223515}.
Tissue Specificity Expressed in the shoot apical region and in young leaves but also detected in the laminar and vasculature of mature leaves. {ECO:0000269|PubMed:19223515}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010916 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15241485 RefSeq NP_196417 194 glucan endo-1,3-beta-glucosidase-like protein 3

Identical Sequences to LMP010916 proteins

Reference Database Accession Length Protein Name
GI:15241485 DBBJ BAC43178.1 194 GPI-anchored protein [Arabidopsis thaliana]
GI:15241485 GenBank AAO39944.1 194 At5g08000 [Arabidopsis thaliana]
GI:15241485 GenBank AFX49223.1 194 Sequence 51056 from patent US 8299318
GI:15241485 GenBank AGF14317.1 194 Sequence 13736 from patent US 8362325
GI:15241485 gnl TAIR 194 glucan endo-1,3-beta-glucosidase-like protein 3 [Arabidopsis thaliana]
GI:15241485 SwissProt Q9SD84.1 194 RecName: Full=PLASMODESMATA CALLOSE-BINDING PROTEIN 2; Short=AtPDCB2; AltName: Full=Glucan endo-1,3-beta-glucosidase-like protein 3; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP010916 proteins

Reference Database Accession Length Protein Name
GI:15241485 GenBank AAM64809.1 194 unknown [Arabidopsis thaliana]
GI:15241485 GenBank EFH47558.1 194 hypothetical protein ARALYDRAFT_350051 [Arabidopsis lyrata subsp. lyrata]
GI:15241485 GenBank EOA21598.1 197 hypothetical protein CARUB_v10002008mg [Capsella rubella]
GI:15241485 RefSeq XP_002871299.1 194 hypothetical protein ARALYDRAFT_350051 [Arabidopsis lyrata subsp. lyrata]
GI:15241485 RefSeq XP_006288700.1 197 hypothetical protein CARUB_v10002008mg [Capsella rubella]
GI:15241485 RefSeq XP_010452771.1 196 PREDICTED: PLASMODESMATA CALLOSE-BINDING PROTEIN 2 [Camelina sativa]