Gene/Proteome Database (LMPD)
Proteins
putative long-chain-alcohol O-fatty-acyltransferase 3 | |
---|---|
Refseq ID | NP_200347 |
Protein GI | 15240498 |
UniProt ID | Q9FJ74 |
mRNA ID | NM_124918 |
Length | 342 |
RefSeq Status | REVIEWED |
MEEELKNFIKLWISAIISISYCYYLSTGIKAGVFRLLSVLPVCALFLVFPLFFSYVHFSGCMAFFLSWLANFKLILFSFDQGPLSPLPRTLSRFICITCFPIKPQQNPNIQNYKIPIWLFAIKVVIFVVLLQMYEYKQYLSPALLLVFNSLHIFLELEIVFMLVKALVFITLGCDLEPQSNEPYLATSLQDFWGRRWNLMVPAILRPAVYLPARRMACRKVNSDQAMFLGVFAAFLVSGAVHEMLFFYLTREVPTGEVTWFFLLHGVCTVAEVAVKKSTFVRRWWRVSPTVSRLLTVGFVVVTSGWFFFPLIRSGIIERLASEALMCIDFVKHKFLLLLLGD |
Gene Information
Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0047196 | IEA:UniProtKB-EC | F | long-chain-alcohol O-fatty-acyltransferase activity |
GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR017088 | Wax synthase |
UniProt Annotations
Entry Information
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 3
Protein Entry
WAXS3_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester. |
Function | Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}. |
Similarity | Belongs to the wax synthase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP010998 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15240498 | RefSeq | NP_200347 | 342 | putative long-chain-alcohol O-fatty-acyltransferase 3 |
Identical Sequences to LMP010998 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15240498 | DBBJ | BAB08553.1 | 342 | wax synthase-like protein [Arabidopsis thaliana] |
GI:15240498 | GenBank | ACC06870.1 | 342 | Sequence 8 from patent US 7332311 |
GI:15240498 | gnl | TAIR | 342 | MBOAT (membrane bound O-acyl transferase) family protein [Arabidopsis thaliana] |
GI:15240498 | SwissProt | Q9FJ74.1 | 342 | RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 3; AltName: Full=Wax synthase 3 [Arabidopsis thaliana] |
Related Sequences to LMP010998 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15240498 | GenBank | EOA15172.1 | 344 | hypothetical protein CARUB_v10028555mg [Capsella rubella] |
GI:15240498 | RefSeq | XP_006282274.1 | 344 | hypothetical protein CARUB_v10028555mg [Capsella rubella] |
GI:15240498 | RefSeq | XP_010449529.1 | 341 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 3 [Camelina sativa] |
GI:15240498 | RefSeq | XP_010449537.1 | 339 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 3 [Camelina sativa] |
GI:15240498 | RefSeq | XP_010443158.1 | 341 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 3 [Camelina sativa] |
GI:15240498 | RefSeq | XP_010482976.1 | 336 | PREDICTED: LOW QUALITY PROTEIN: probable long-chain-alcohol O-fatty-acyltransferase 3 [Camelina sativa] |