Gene/Proteome Database (LMPD)

LMPD ID
LMP010998
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 3
Gene Symbol
Synonyms
MTE17.7; MTE17_7
Alternate Names
putative long-chain-alcohol O-fatty-acyltransferase 3
Chromosome
5
EC Number
2.3.1.75

Proteins

putative long-chain-alcohol O-fatty-acyltransferase 3
Refseq ID NP_200347
Protein GI 15240498
UniProt ID Q9FJ74
mRNA ID NM_124918
Length 342
RefSeq Status REVIEWED
MEEELKNFIKLWISAIISISYCYYLSTGIKAGVFRLLSVLPVCALFLVFPLFFSYVHFSGCMAFFLSWLANFKLILFSFDQGPLSPLPRTLSRFICITCFPIKPQQNPNIQNYKIPIWLFAIKVVIFVVLLQMYEYKQYLSPALLLVFNSLHIFLELEIVFMLVKALVFITLGCDLEPQSNEPYLATSLQDFWGRRWNLMVPAILRPAVYLPARRMACRKVNSDQAMFLGVFAAFLVSGAVHEMLFFYLTREVPTGEVTWFFLLHGVCTVAEVAVKKSTFVRRWWRVSPTVSRLLTVGFVVVTSGWFFFPLIRSGIIERLASEALMCIDFVKHKFLLLLLGD

Gene Information

Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047196 IEA:UniProtKB-EC F long-chain-alcohol O-fatty-acyltransferase activity
GO:0006629 IEA:UniProtKB-KW P lipid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-282 cuticular wax biosynthesis
PWY-5884 wax esters biosynthesis I

Domain Information

InterPro Annotations

Accession Description
IPR017088 Wax synthase

UniProt Annotations

Entry Information

Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 3
Protein Entry
WAXS3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.
Function Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}.
Similarity Belongs to the wax synthase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP010998 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15240498 RefSeq NP_200347 342 putative long-chain-alcohol O-fatty-acyltransferase 3

Identical Sequences to LMP010998 proteins

Reference Database Accession Length Protein Name
GI:15240498 DBBJ BAB08553.1 342 wax synthase-like protein [Arabidopsis thaliana]
GI:15240498 GenBank ACC06870.1 342 Sequence 8 from patent US 7332311
GI:15240498 gnl TAIR 342 MBOAT (membrane bound O-acyl transferase) family protein [Arabidopsis thaliana]
GI:15240498 SwissProt Q9FJ74.1 342 RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 3; AltName: Full=Wax synthase 3 [Arabidopsis thaliana]

Related Sequences to LMP010998 proteins

Reference Database Accession Length Protein Name
GI:15240498 GenBank EOA15172.1 344 hypothetical protein CARUB_v10028555mg [Capsella rubella]
GI:15240498 RefSeq XP_006282274.1 344 hypothetical protein CARUB_v10028555mg [Capsella rubella]
GI:15240498 RefSeq XP_010449529.1 341 PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 3 [Camelina sativa]
GI:15240498 RefSeq XP_010449537.1 339 PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 3 [Camelina sativa]
GI:15240498 RefSeq XP_010443158.1 341 PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 3 [Camelina sativa]
GI:15240498 RefSeq XP_010482976.1 336 PREDICTED: LOW QUALITY PROTEIN: probable long-chain-alcohol O-fatty-acyltransferase 3 [Camelina sativa]