Gene/Proteome Database (LMPD)

LMPD ID
LMP011000
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 5
Gene Symbol
Synonyms
MTE17.5; MTE17_5
Alternate Names
putative long-chain-alcohol O-fatty-acyltransferase 5
Chromosome
5
EC Number
2.3.1.75

Proteins

putative long-chain-alcohol O-fatty-acyltransferase 5
Refseq ID NP_200345
Protein GI 15240496
UniProt ID Q9FJ76
mRNA ID NM_124916
Length 333
RefSeq Status REVIEWED
MDEELKNLIKVWVSAIISISYCYYIPPRIKSGAPRFLSVSPVLALFLVLPLFFSSLHLSLITAFFLTWLANFKLILFSFDKGPLIPIPTNFPRFFCFTCFPIKVQQNPKSQNHLPKLVFAIKLAIFAVLLHLYSYRQNLSPTILLGLYFVHLYLEIEIILTFVKVVVFISLGCDLEPQSNKPYLATSLQDFWGRRWNLMVPAILRPAVYAPMRRVSERKMSSGWALFPGILAAFIVSGLVHELLFFYLIREMPTGEVTLFFVLHGVCTAVELAVKKKTTVAQRWRLSPGVSRVLTVGFVFVTGGWLFTPQLKRSGVMERFTSEAVLLVEFIKR

Gene Information

Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 5
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047196 IEA:UniProtKB-EC F long-chain-alcohol O-fatty-acyltransferase activity
GO:0006629 IEA:UniProtKB-KW P lipid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-282 cuticular wax biosynthesis
PWY-5884 wax esters biosynthesis I

Domain Information

InterPro Annotations

Accession Description
IPR017088 Wax synthase

UniProt Annotations

Entry Information

Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 5
Protein Entry
WAXS5_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.
Function Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}.
Similarity Belongs to the wax synthase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011000 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15240496 RefSeq NP_200345 333 putative long-chain-alcohol O-fatty-acyltransferase 5

Identical Sequences to LMP011000 proteins

Reference Database Accession Length Protein Name
GI:15240496 DBBJ BAB08551.1 333 unnamed protein product [Arabidopsis thaliana]
GI:15240496 GenBank AAM61298.1 333 wax synthase-like protein [Arabidopsis thaliana]
GI:15240496 GenBank ACC06872.1 333 Sequence 12 from patent US 7332311
GI:15240496 GenBank ACW87603.1 333 Sequence 4364 from patent US 7569389
GI:15240496 gnl TAIR 333 putative long-chain-alcohol O-fatty-acyltransferase 5 [Arabidopsis thaliana]
GI:15240496 SwissProt Q9FJ76.1 333 RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 5; AltName: Full=Wax synthase 5 [Arabidopsis thaliana]

Related Sequences to LMP011000 proteins

Reference Database Accession Length Protein Name
GI:15240496 GenBank EFH42350.1 335 long-chain-alcohol O-fatty-acyltransferase family protein, partial [Arabidopsis lyrata subsp. lyrata]
GI:15240496 GenBank EOA14627.1 334 hypothetical protein CARUB_v10027886mg [Capsella rubella]
GI:15240496 RefSeq XP_002866091.1 335 long-chain-alcohol O-fatty-acyltransferase family protein, partial [Arabidopsis lyrata subsp. lyrata]
GI:15240496 RefSeq XP_006281729.1 334 hypothetical protein CARUB_v10027886mg [Capsella rubella]
GI:15240496 RefSeq XP_010449487.1 348 PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 5 [Camelina sativa]
GI:15240496 RefSeq XP_010443156.1 348 PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 5 [Camelina sativa]