Gene/Proteome Database (LMPD)
Proteins
| putative long-chain-alcohol O-fatty-acyltransferase 7 | |
|---|---|
| Refseq ID | NP_200343 |
| Protein GI | 15240494 |
| UniProt ID | Q9FJ78 |
| mRNA ID | NM_124914 |
| Length | 339 |
| RefSeq Status | REVIEWED |
| MEEEIKSLINVGFLTIISVSYCYCLPPRIKSGVLRLLSIFPVCVLLVVLPLFFSFSIFTSTTAFFLSAIANSRLILFSFDQGPLFPLPSNLFRFTCFTCFPIQRQQNPKSQDHLSTYVFPVKIAIFVVLLYVHNDIQNLPRTFLLCLHPLYVYLLLEILLTLLRILMTIILGCDLEPHFHEPYLATSLQDFWGRRWNLIVSASLRAIVYTPVRRVCQRVMSSDYAMLIGVFATFVTSGVAHEVVFFYITRAMPTGEVALFFLLHGVCTVAEVAAKRTAFVRRWPVRPVVSWMFTIAFVNVTAGWLFFPQLIRNNLGERCSNEISLLIDFFRSKLFYFPQ | |
Gene Information
Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 7
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0047196 | IEA:UniProtKB-EC | F | long-chain-alcohol O-fatty-acyltransferase activity |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR017088 | Wax synthase |
UniProt Annotations
Entry Information
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 7
Protein Entry
WAXS7_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester. |
| Function | Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}. |
| Similarity | Belongs to the wax synthase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011002 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15240494 | RefSeq | NP_200343 | 339 | putative long-chain-alcohol O-fatty-acyltransferase 7 |
Identical Sequences to LMP011002 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15240494 | DBBJ | BAB08549.1 | 339 | wax synthase-like protein [Arabidopsis thaliana] |
| GI:15240494 | GenBank | ACC06874.1 | 339 | Sequence 16 from patent US 7332311 |
| GI:15240494 | gnl | TAIR | 339 | putative long-chain-alcohol O-fatty-acyltransferase 7 [Arabidopsis thaliana] |
| GI:15240494 | SwissProt | Q9FJ78.1 | 339 | RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 7; AltName: Full=Wax synthase 7 [Arabidopsis thaliana] |
Related Sequences to LMP011002 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15240494 | EMBL | CDY54708.1 | 350 | BnaAnng13380D [Brassica napus] |
| GI:15240494 | EMBL | CDX75136.1 | 350 | BnaC09g25460D [Brassica napus] |
| GI:15240494 | GenBank | EOA12646.1 | 345 | hypothetical protein CARUB_v10027662mg [Capsella rubella] |
| GI:15240494 | RefSeq | XP_006279748.1 | 345 | hypothetical protein CARUB_v10027662mg [Capsella rubella] |
| GI:15240494 | RefSeq | XP_009113503.1 | 350 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 7 [Brassica rapa] |
| GI:15240494 | RefSeq | XP_010449475.1 | 340 | PREDICTED: LOW QUALITY PROTEIN: probable long-chain-alcohol O-fatty-acyltransferase 7 [Camelina sativa] |