Gene/Proteome Database (LMPD)
Proteins
putative long-chain-alcohol O-fatty-acyltransferase 7 | |
---|---|
Refseq ID | NP_200343 |
Protein GI | 15240494 |
UniProt ID | Q9FJ78 |
mRNA ID | NM_124914 |
Length | 339 |
RefSeq Status | REVIEWED |
MEEEIKSLINVGFLTIISVSYCYCLPPRIKSGVLRLLSIFPVCVLLVVLPLFFSFSIFTSTTAFFLSAIANSRLILFSFDQGPLFPLPSNLFRFTCFTCFPIQRQQNPKSQDHLSTYVFPVKIAIFVVLLYVHNDIQNLPRTFLLCLHPLYVYLLLEILLTLLRILMTIILGCDLEPHFHEPYLATSLQDFWGRRWNLIVSASLRAIVYTPVRRVCQRVMSSDYAMLIGVFATFVTSGVAHEVVFFYITRAMPTGEVALFFLLHGVCTVAEVAAKRTAFVRRWPVRPVVSWMFTIAFVNVTAGWLFFPQLIRNNLGERCSNEISLLIDFFRSKLFYFPQ |
Gene Information
Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 7
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0047196 | IEA:UniProtKB-EC | F | long-chain-alcohol O-fatty-acyltransferase activity |
GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR017088 | Wax synthase |
UniProt Annotations
Entry Information
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 7
Protein Entry
WAXS7_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester. |
Function | Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}. |
Similarity | Belongs to the wax synthase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011002 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15240494 | RefSeq | NP_200343 | 339 | putative long-chain-alcohol O-fatty-acyltransferase 7 |
Identical Sequences to LMP011002 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15240494 | DBBJ | BAB08549.1 | 339 | wax synthase-like protein [Arabidopsis thaliana] |
GI:15240494 | GenBank | ACC06874.1 | 339 | Sequence 16 from patent US 7332311 |
GI:15240494 | gnl | TAIR | 339 | putative long-chain-alcohol O-fatty-acyltransferase 7 [Arabidopsis thaliana] |
GI:15240494 | SwissProt | Q9FJ78.1 | 339 | RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 7; AltName: Full=Wax synthase 7 [Arabidopsis thaliana] |
Related Sequences to LMP011002 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15240494 | EMBL | CDY54708.1 | 350 | BnaAnng13380D [Brassica napus] |
GI:15240494 | EMBL | CDX75136.1 | 350 | BnaC09g25460D [Brassica napus] |
GI:15240494 | GenBank | EOA12646.1 | 345 | hypothetical protein CARUB_v10027662mg [Capsella rubella] |
GI:15240494 | RefSeq | XP_006279748.1 | 345 | hypothetical protein CARUB_v10027662mg [Capsella rubella] |
GI:15240494 | RefSeq | XP_009113503.1 | 350 | PREDICTED: probable long-chain-alcohol O-fatty-acyltransferase 7 [Brassica rapa] |
GI:15240494 | RefSeq | XP_010449475.1 | 340 | PREDICTED: LOW QUALITY PROTEIN: probable long-chain-alcohol O-fatty-acyltransferase 7 [Camelina sativa] |