Gene/Proteome Database (LMPD)
Proteins
| putative long-chain-alcohol O-fatty-acyltransferase 9 | |
|---|---|
| Refseq ID | NP_174709 |
| Protein GI | 15218662 |
| UniProt ID | Q4PT07 |
| mRNA ID | NM_103172 |
| Length | 341 |
| RefSeq Status | REVIEWED |
| MEEELKNFIIVWISAIISVSYCYYISANIKTGVLRLFSVLPICGLFFVLPLFFSSVHFSSSTAFYLSEMASLKLILFAFDQGPLFPVAPNLIQFVCFTCFPIKLQRNPKSQPSQNHFHKRAFAIKIMIFGVVLHVYNYSHFLPQTVLLSLCFLHLYVELEILLGPLKVLLSMALGCDLEPQFNKPYLATSLQDFWGRRWNLMVSSVLRSGIYNPVRCACQRPMNSGWARFMGYLVTFLVSGLFHELVYFYITRETPTWEVTLFFVLNGVCTGTEVAVKRTAFLQRWWPVRSSVSRLLTMGFVVVTGGLLFFPLFIRSGMMERRANETLFFLDFVKRKFSIF | |
Gene Information
Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 9
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0047196 | IEA:UniProtKB-EC | F | long-chain-alcohol O-fatty-acyltransferase activity |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR017088 | Wax synthase |
UniProt Annotations
Entry Information
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 9
Protein Entry
WAXS9_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester. |
| Function | Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}. |
| Sequence Caution | Sequence=AAF79268.1; Type=Erroneous gene model prediction; Note=The predicted gene has been split into 2 genes: At1g34490 and At1g34500.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the wax synthase family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011004 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15218662 | RefSeq | NP_174709 | 341 | putative long-chain-alcohol O-fatty-acyltransferase 9 |
Identical Sequences to LMP011004 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15218662 | GenBank | AAY78636.1 | 341 | membrane bound O-acyl transferase family protein [Arabidopsis thaliana] |
| GI:15218662 | GenBank | AEE31720.1 | 341 | putative long-chain-alcohol O-fatty-acyltransferase 9 [Arabidopsis thaliana] |
| GI:15218662 | SwissProt | Q4PT07.1 | 341 | RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 9; AltName: Full=Wax synthase 9 [Arabidopsis thaliana] |
Related Sequences to LMP011004 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15218662 | GenBank | AAF79268.1 | 621 | F12K21.19 [Arabidopsis thaliana] |
| GI:15218662 | GenBank | EOA14889.1 | 340 | hypothetical protein CARUB_v10028218mg [Capsella rubella] |
| GI:15218662 | GenBank | ESQ42916.1 | 332 | hypothetical protein EUTSA_v10015854mg, partial [Eutrema salsugineum] |
| GI:15218662 | RefSeq | XP_006281991.1 | 340 | hypothetical protein CARUB_v10028218mg [Capsella rubella] |
| GI:15218662 | RefSeq | XP_006401463.1 | 332 | hypothetical protein EUTSA_v10015854mg, partial [Eutrema salsugineum] |
| GI:15218662 | RefSeq | XP_010463134.1 | 340 | PREDICTED: LOW QUALITY PROTEIN: probable long-chain-alcohol O-fatty-acyltransferase 9 [Camelina sativa] |