Gene/Proteome Database (LMPD)

LMPD ID
LMP011004
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 9
Gene Symbol
Synonyms
F12K21.19; F12K21_19
Alternate Names
putative long-chain-alcohol O-fatty-acyltransferase 9
Chromosome
1
EC Number
2.3.1.75

Proteins

putative long-chain-alcohol O-fatty-acyltransferase 9
Refseq ID NP_174709
Protein GI 15218662
UniProt ID Q4PT07
mRNA ID NM_103172
Length 341
RefSeq Status REVIEWED
MEEELKNFIIVWISAIISVSYCYYISANIKTGVLRLFSVLPICGLFFVLPLFFSSVHFSSSTAFYLSEMASLKLILFAFDQGPLFPVAPNLIQFVCFTCFPIKLQRNPKSQPSQNHFHKRAFAIKIMIFGVVLHVYNYSHFLPQTVLLSLCFLHLYVELEILLGPLKVLLSMALGCDLEPQFNKPYLATSLQDFWGRRWNLMVSSVLRSGIYNPVRCACQRPMNSGWARFMGYLVTFLVSGLFHELVYFYITRETPTWEVTLFFVLNGVCTGTEVAVKRTAFLQRWWPVRSSVSRLLTMGFVVVTGGLLFFPLFIRSGMMERRANETLFFLDFVKRKFSIF

Gene Information

Entrez Gene ID
Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 9
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047196 IEA:UniProtKB-EC F long-chain-alcohol O-fatty-acyltransferase activity
GO:0006629 IEA:UniProtKB-KW P lipid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-282 cuticular wax biosynthesis
PWY-5884 wax esters biosynthesis I

Domain Information

InterPro Annotations

Accession Description
IPR017088 Wax synthase

UniProt Annotations

Entry Information

Gene Name
putative long-chain-alcohol O-fatty-acyltransferase 9
Protein Entry
WAXS9_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + a long-chain alcohol = CoA + a long-chain ester.
Function Catalyzes the final step in the synthesis of long-chain linear esters (waxes). {ECO:0000250}.
Sequence Caution Sequence=AAF79268.1; Type=Erroneous gene model prediction; Note=The predicted gene has been split into 2 genes: At1g34490 and At1g34500.; Evidence={ECO:0000305};
Similarity Belongs to the wax synthase family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011004 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15218662 RefSeq NP_174709 341 putative long-chain-alcohol O-fatty-acyltransferase 9

Identical Sequences to LMP011004 proteins

Reference Database Accession Length Protein Name
GI:15218662 GenBank AAY78636.1 341 membrane bound O-acyl transferase family protein [Arabidopsis thaliana]
GI:15218662 GenBank AEE31720.1 341 putative long-chain-alcohol O-fatty-acyltransferase 9 [Arabidopsis thaliana]
GI:15218662 SwissProt Q4PT07.1 341 RecName: Full=Probable long-chain-alcohol O-fatty-acyltransferase 9; AltName: Full=Wax synthase 9 [Arabidopsis thaliana]

Related Sequences to LMP011004 proteins

Reference Database Accession Length Protein Name
GI:15218662 GenBank AAF79268.1 621 F12K21.19 [Arabidopsis thaliana]
GI:15218662 GenBank EOA14889.1 340 hypothetical protein CARUB_v10028218mg [Capsella rubella]
GI:15218662 GenBank ESQ42916.1 332 hypothetical protein EUTSA_v10015854mg, partial [Eutrema salsugineum]
GI:15218662 RefSeq XP_006281991.1 340 hypothetical protein CARUB_v10028218mg [Capsella rubella]
GI:15218662 RefSeq XP_006401463.1 332 hypothetical protein EUTSA_v10015854mg, partial [Eutrema salsugineum]
GI:15218662 RefSeq XP_010463134.1 340 PREDICTED: LOW QUALITY PROTEIN: probable long-chain-alcohol O-fatty-acyltransferase 9 [Camelina sativa]