Gene/Proteome Database (LMPD)
Proteins
| membrane-associated kinase regulator | |
|---|---|
| Refseq ID | NP_197995 |
| Protein GI | 15239627 |
| UniProt ID | Q3E936 |
| mRNA ID | NM_122524 |
| Length | 341 |
| RefSeq Status | REVIEWED |
| MRRQPPRPRNSPPQSHSSPSSSSSEFEFNISISPRKASSSLCPADELFYKGQLLPLQLSPRLSLVRTLGSSTSSSDYTSSSSSSVATSAARDSTESNSSTDSTASFPLLHPPPLDCCDSSRPSSVTDDEDFFFKPPKNKSSSGGFSLSRFSSVFKKDPKTNLHHHSSSSSTATTAAAPSSVKRMSSTAKEVIRKYMKKVKPLYEKLSPKQSSNIKTESSSSLKDSGNNIRGTTTVTTVTAAPTVVSSGGGLSISFSGNLMKYTKRGRCAASCPSSMRSSPNHSGVLTRGGFPVHQGSCSSSSSNNNSVSSSMEELQSAIQGAIAHCKNSMLQKNLVSSLEI | |
Gene Information
Entrez Gene ID
Gene Name
membrane-associated kinase regulator
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0019210 | IMP:TAIR | F | kinase inhibitor activity |
| GO:0009742 | IEA:UniProtKB-KW | P | brassinosteroid mediated signaling pathway |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
| GO:0042326 | IMP:GOC | P | negative regulation of phosphorylation |
| GO:0009741 | IMP:TAIR | P | response to brassinosteroid |
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
membrane-associated kinase regulator
Protein Entry
MAKR1_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Function | May negatively regulate brassinosteroid signaling. |
| Subcellular Location | Cell membrane {ECO:0000250}. |
| Subunit | A C-terminus-derived peptide binds BRI1 in vitro. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011006 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15239627 | RefSeq | NP_197995 | 341 | membrane-associated kinase regulator |
Identical Sequences to LMP011006 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15239627 | gnl | TAIR | 341 | membrane-associated kinase regulator [Arabidopsis thaliana] |
| GI:15239627 | SwissProt | Q3E936.1 | 341 | RecName: Full=Probable membrane-associated kinase regulator 1 [Arabidopsis thaliana] |
Related Sequences to LMP011006 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15239627 | GenBank | EFH50566.1 | 335 | hypothetical protein ARALYDRAFT_489466 [Arabidopsis lyrata subsp. lyrata] |
| GI:15239627 | RefSeq | XP_002874307.1 | 335 | hypothetical protein ARALYDRAFT_489466 [Arabidopsis lyrata subsp. lyrata] |
| GI:15239627 | RefSeq | XP_006288080.1 | 348 | hypothetical protein CARUB_v10001312mg [Capsella rubella] |
| GI:15239627 | RefSeq | XP_010421496.1 | 344 | PREDICTED: probable membrane-associated kinase regulator 1 [Camelina sativa] |
| GI:15239627 | RefSeq | XP_010454976.1 | 344 | PREDICTED: probable membrane-associated kinase regulator 1 [Camelina sativa] |
| GI:15239627 | RefSeq | XP_010493888.1 | 343 | PREDICTED: probable membrane-associated kinase regulator 1 [Camelina sativa] |