Gene/Proteome Database (LMPD)

LMPD ID
LMP011013
Gene ID
826765
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
glutathione peroxidase 6
Gene Symbol
GPX6
Synonyms
ATGPX6; glutathione peroxidase 6; GPX6; LSC803; PHGPX; T5C23.30; T5C23_30
Alternate Names
glutathione peroxidase 6
Chromosome
4
EC Number
1.11.1.12
Summary
Encodes glutathione peroxidase.
Orthologs
View orthologs and multiple alignments for GPX6

Proteins

glutathione peroxidase 6
Refseq ID NP_192897
Protein GI 30681827
UniProt ID O48646
mRNA ID NM_117229
Length 232
RefSeq Status REVIEWED
MLRSSIRLLYIRRTSPLLRSLSSSSSSSSSKRFDSAKPLFNSHRIISLPISTTGAKLSRSEHSMAASSEPKSLYDFTVKDAKGNDVDLSIYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYKGHGFEILAFPCNQFGNQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDKAAPVYKFLKSSKGGLFGDGIKWNFAKFLVDKDGNVVDRFAPTTSPLSIEKDVKKLLGVTA

Gene Information

Entrez Gene ID
826765
Gene Name
glutathione peroxidase 6
Gene Symbol
GPX6
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0048046 IDA:TAIR C apoplast
GO:0009507 IDA:TAIR C chloroplast
GO:0005829 IDA:TAIR C cytosol
GO:0005739 IDA:TAIR C mitochondrion
GO:0005886 IDA:TAIR C plasma membrane
GO:0004602 ISS:TAIR F glutathione peroxidase activity
GO:0047066 IEA:UniProtKB-EC F phospholipid-hydroperoxide glutathione peroxidase activity
GO:0046686 IEP:TAIR P response to cadmium ion
GO:0006979 IEA:InterPro P response to oxidative stress
GO:0009651 IEP:TAIR P response to salt stress

KEGG Pathway Links

KEGG Pathway ID Description
ath00590 Arachidonic acid metabolism
ath00480 Glutathione metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
6254372 Synthesis of 12-eicosatetraenoic acid derivatives
6254371 Synthesis of 5-eicosatetraenoic acids

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 6
Protein Entry
GPX6_ARATH
UniProt ID
O48646
Species
Arabidopsis

Comments

Comment Type Description
Catalytic Activity 2 glutathione + a lipid hydroperoxide = glutathione disulfide + lipid + 2 H(2)O.
Function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. {ECO:0000250}.
Induction By salt stress, osmotic stress, cold treatment, and metals. Up-regulated by salicylic acid (SA), jasmonic acid (JA), abscisic acid (ABA) and auxin. {ECO:0000269|PubMed:14617062, ECO:0000269|PubMed:9511228, ECO:0000269|Ref.1}.
Sequence Caution Sequence=AAC09173.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=AAM66969.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA24226.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAB39931.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=CAB78203.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the glutathione peroxidase family. {ECO:0000305}.
Subcellular Location Mitochondrion {ECO:0000305}.
Tissue Specificity Expressed at a low but detectable level in leaves, stems, and flowers, but at a higher level in siliques and even higher in roots. Predominantly expressed in seeds. {ECO:0000269|PubMed:14617062, ECO:0000269|Ref.1}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011013 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30681827 RefSeq NP_192897 232 glutathione peroxidase 6

Identical Sequences to LMP011013 proteins

Reference Database Accession Length Protein Name
GI:30681827 GenBank AAK63967.1 232 AT4g11600/T5C23_30 [Arabidopsis thaliana]
GI:30681827 GenBank AAL76133.1 232 AT4g11600/T5C23_30 [Arabidopsis thaliana]
GI:30681827 GenBank ADT60568.1 232 Sequence 2026 from patent US 7847156
GI:30681827 GenBank AEE83029.1 232 glutathione peroxidase 6 [Arabidopsis thaliana]
GI:30681827 SwissProt O48646.2 232 RecName: Full=Probable phospholipid hydroperoxide glutathione peroxidase 6, mitochondrial; Short=AtGPX1; Short=PHGPx; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011013 proteins

Reference Database Accession Length Protein Name
GI:30681827 DBBJ BAJ33626.1 234 unnamed protein product [Eutrema halophilum]
GI:30681827 GenBank ACP28875.1 234 glutathionine peroxidase 6 [Eutrema halophilum]
GI:30681827 GenBank EOA21472.1 235 hypothetical protein CARUB_v10001865mg [Capsella rubella]
GI:30681827 GenBank ESQ38333.1 234 hypothetical protein EUTSA_v10028932mg [Eutrema salsugineum]
GI:30681827 RefSeq XP_006288574.1 235 hypothetical protein CARUB_v10001865mg [Capsella rubella]
GI:30681827 RefSeq XP_006396880.1 234 hypothetical protein EUTSA_v10028932mg [Eutrema salsugineum]