Gene/Proteome Database (LMPD)
Proteins
| putative S-acyltransferase | |
|---|---|
| Refseq ID | NP_566348 |
| Protein GI | 18398471 |
| UniProt ID | Q93VV0 |
| mRNA ID | NM_111766 |
| Length | 286 |
| RefSeq Status | REVIEWED |
| MKRKGVGFSLPVTVVMLVIGFIYFASVFTFIDRWFSLTSSPGIANAAAFTALALMCIYNYSIAVFRDPGRVPLNYMPDVEDPESPVHEIKRKGGDLRYCQKCSHFKPPRAHHCRVCKRCVLRMDHHCIWINNCVGHTNYKVFFVFVVYAVTACVYSLVLLVGSLTVEPQDEEEEMGSYLRTIYVISAFLLIPLSIALGVLLGWHIYLILQNKTTIEYHEGVRAMWLAEKGGQVYKHPYDIGAYENLTLILGPNILSWLCPTSRHIGSGVRFRTAFDSIPDSSETKH | |
Gene Information
Entrez Gene ID
Gene Name
putative S-acyltransferase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
putative S-acyltransferase
Protein Entry
ZDHC6_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. {ECO:0000250}. |
| Function | Palmitoyl acyltransferase. {ECO:0000250}. |
| Sequence Caution | Sequence=AAF14029.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}. |
| Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
| Subcellular Location | Golgi apparatus membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011031 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 18398471 | RefSeq | NP_566348 | 286 | putative S-acyltransferase |
Identical Sequences to LMP011031 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18398471 | GenBank | AAK62574.1 | 286 | AT3g09320/F3L24_19 [Arabidopsis thaliana] |
| GI:18398471 | GenBank | AAL15371.1 | 286 | AT3g09320/F3L24_19 [Arabidopsis thaliana] |
| GI:18398471 | GenBank | AEE74750.1 | 286 | putative S-acyltransferase [Arabidopsis thaliana] |
| GI:18398471 | SwissProt | Q93VV0.1 | 286 | RecName: Full=Probable protein S-acyltransferase 16; AltName: Full=Probable palmitoyltransferase At3g09320; AltName: Full=Zinc finger DHHC domain-containing protein At3g09320 [Arabidopsis thaliana] |
Related Sequences to LMP011031 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:18398471 | GenBank | AAF14029.1 | 287 | unknown protein [Arabidopsis thaliana] |
| GI:18398471 | GenBank | EFH60986.1 | 286 | zinc finger family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18398471 | GenBank | EOA32668.1 | 286 | hypothetical protein CARUB_v10015965mg [Capsella rubella] |
| GI:18398471 | RefSeq | XP_002884727.1 | 286 | zinc finger family protein [Arabidopsis lyrata subsp. lyrata] |
| GI:18398471 | RefSeq | XP_006299770.1 | 286 | hypothetical protein CARUB_v10015965mg [Capsella rubella] |
| GI:18398471 | RefSeq | XP_010464573.1 | 286 | PREDICTED: probable protein S-acyltransferase 16 [Camelina sativa] |