Gene/Proteome Database (LMPD)

LMPD ID
LMP011049
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
probable sodium/metabolite cotransporter BASS3
Gene Symbol
Alternate Names
probable sodium/metabolite cotransporter BASS3
Chromosome
3

Proteins

probable sodium/metabolite cotransporter BASS3
Refseq ID NP_566764
Protein GI 18404505
UniProt ID Q8RXE8
mRNA ID NM_113437
Length 431
RefSeq Status REVIEWED
MTLIASLSLPPPAIQRQSLSEFHNLPAKSQSFNCQFRSSSSPLSSLHSSSLSNFLDFRLRRRNSGLVPVVACSTTPFMGRVGLHWRDGNMSLLSFCGGTDVTEKADSSQFWSALLPFVVALTAVAALSYPPSFTWVSKDLYAPALGGIMLSIGIQLSVDDFALAFKRPVPLSVGFVAQYVLKPLLGVLVANAFGMPRTFYAGFILTCCVAGAQLSSYASSLSKADVAMSILLTSSTTIASVIFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPITLGLVLNTYAKPVVTLLQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIVPIVTFHAVAFALGYWFSKIPGLRQEEEVSRTISLCTGMQSSTLAGLLASQFLGSSQAVPAACSVVVMAIMGLCLASFWGNGFRIRDVLSLSTPQSTGYTAES

Gene Information

Entrez Gene ID
Gene Name
probable sodium/metabolite cotransporter BASS3
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009941 IDA:UniProtKB C chloroplast envelope
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008508 IEA:InterPro F bile acid:sodium symporter activity

REACTOME Pathway Links

REACTOME Pathway ID Description
6253667 SLC-mediated transmembrane transport
6253668 Transmembrane transport of small molecules
6254194 Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds

Domain Information

InterPro Annotations

Accession Description
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
probable sodium/metabolite cotransporter BASS3
Protein Entry
BASS3_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function May function as sodium-coupled metabolite transporter across the chloroplast envelope. {ECO:0000250}.
Sequence Caution Sequence=BAB01312.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305|PubMed:19542295}; Multi-pass membrane protein {ECO:0000305|PubMed:19542295}. Plastid, chloroplast envelope {ECO:0000305|PubMed:19542295}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011049 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18404505 RefSeq NP_566764 431 probable sodium/metabolite cotransporter BASS3

Identical Sequences to LMP011049 proteins

Reference Database Accession Length Protein Name
GI:18404505 GenBank ACW85367.1 431 Sequence 1301 from patent US 7569389
GI:18404505 GenBank ACW88230.1 431 Sequence 5222 from patent US 7569389
GI:18404505 GenBank ACX19788.1 431 Sequence 48091 from patent US 7569389
GI:18404505 GenBank ACX20205.1 431 Sequence 48654 from patent US 7569389
GI:18404505 GenBank AEE77008.1 431 probable sodium/metabolite cotransporter BASS3 [Arabidopsis thaliana]
GI:18404505 SwissProt Q8RXE8.1 431 RecName: Full=Probable sodium/metabolite cotransporter BASS3, chloroplastic; AltName: Full=Bile acid transporter 3; AltName: Full=Bile acid-sodium symporter family protein 3; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011049 proteins

Reference Database Accession Length Protein Name
GI:18404505 GenBank AAM63721.1 431 unknown [Arabidopsis thaliana]
GI:18404505 GenBank ACW87933.1 431 Sequence 4817 from patent US 7569389
GI:18404505 GenBank ACX19477.1 431 Sequence 47669 from patent US 7569389
GI:18404505 GenBank EFH61963.1 424 bile acid:sodium symporter family protein [Arabidopsis lyrata subsp. lyrata]
GI:18404505 RefSeq XP_002885704.1 424 bile acid:sodium symporter family protein [Arabidopsis lyrata subsp. lyrata]
GI:18404505 RefSeq XP_010488641.1 427 PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic [Camelina sativa]