Gene/Proteome Database (LMPD)
Proteins
probable sodium/metabolite cotransporter BASS3 | |
---|---|
Refseq ID | NP_566764 |
Protein GI | 18404505 |
UniProt ID | Q8RXE8 |
mRNA ID | NM_113437 |
Length | 431 |
RefSeq Status | REVIEWED |
MTLIASLSLPPPAIQRQSLSEFHNLPAKSQSFNCQFRSSSSPLSSLHSSSLSNFLDFRLRRRNSGLVPVVACSTTPFMGRVGLHWRDGNMSLLSFCGGTDVTEKADSSQFWSALLPFVVALTAVAALSYPPSFTWVSKDLYAPALGGIMLSIGIQLSVDDFALAFKRPVPLSVGFVAQYVLKPLLGVLVANAFGMPRTFYAGFILTCCVAGAQLSSYASSLSKADVAMSILLTSSTTIASVIFTPLLSGLLIGSVVPVDAVAMSKSILQVVLVPITLGLVLNTYAKPVVTLLQPVMPFVAMVCTSLCIGSPLSINRSQILSAEGLGLIVPIVTFHAVAFALGYWFSKIPGLRQEEEVSRTISLCTGMQSSTLAGLLASQFLGSSQAVPAACSVVVMAIMGLCLASFWGNGFRIRDVLSLSTPQSTGYTAES |
Gene Information
Entrez Gene ID
Gene Name
probable sodium/metabolite cotransporter BASS3
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0009941 | IDA:UniProtKB | C | chloroplast envelope |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008508 | IEA:InterPro | F | bile acid:sodium symporter activity |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002657 | Bile acid:sodium symporter/arsenical resistance protein Acr3 |
UniProt Annotations
Entry Information
Gene Name
probable sodium/metabolite cotransporter BASS3
Protein Entry
BASS3_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Function | May function as sodium-coupled metabolite transporter across the chloroplast envelope. {ECO:0000250}. |
Sequence Caution | Sequence=BAB01312.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305|PubMed:19542295}; Multi-pass membrane protein {ECO:0000305|PubMed:19542295}. Plastid, chloroplast envelope {ECO:0000305|PubMed:19542295}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011049 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18404505 | RefSeq | NP_566764 | 431 | probable sodium/metabolite cotransporter BASS3 |
Identical Sequences to LMP011049 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18404505 | GenBank | ACW85367.1 | 431 | Sequence 1301 from patent US 7569389 |
GI:18404505 | GenBank | ACW88230.1 | 431 | Sequence 5222 from patent US 7569389 |
GI:18404505 | GenBank | ACX19788.1 | 431 | Sequence 48091 from patent US 7569389 |
GI:18404505 | GenBank | ACX20205.1 | 431 | Sequence 48654 from patent US 7569389 |
GI:18404505 | GenBank | AEE77008.1 | 431 | probable sodium/metabolite cotransporter BASS3 [Arabidopsis thaliana] |
GI:18404505 | SwissProt | Q8RXE8.1 | 431 | RecName: Full=Probable sodium/metabolite cotransporter BASS3, chloroplastic; AltName: Full=Bile acid transporter 3; AltName: Full=Bile acid-sodium symporter family protein 3; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP011049 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18404505 | GenBank | AAM63721.1 | 431 | unknown [Arabidopsis thaliana] |
GI:18404505 | GenBank | ACW87933.1 | 431 | Sequence 4817 from patent US 7569389 |
GI:18404505 | GenBank | ACX19477.1 | 431 | Sequence 47669 from patent US 7569389 |
GI:18404505 | GenBank | EFH61963.1 | 424 | bile acid:sodium symporter family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18404505 | RefSeq | XP_002885704.1 | 424 | bile acid:sodium symporter family protein [Arabidopsis lyrata subsp. lyrata] |
GI:18404505 | RefSeq | XP_010488641.1 | 427 | PREDICTED: probable sodium/metabolite cotransporter BASS3, chloroplastic [Camelina sativa] |