Gene/Proteome Database (LMPD)

LMPD ID
LMP011070
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Gene Symbol
Synonyms
F11L15.3
Chromosome
2

Proteins

protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Refseq ID NP_566126
Protein GI 18407534
UniProt ID Q7EB72
mRNA ID NM_130380
Length 183
RefSeq Status REVIEWED
MGYRRSYAITFVALVAALWSVTKAQPSSSCVSTLTTLSPCLSYITGNSTTPSQPCCSRLDSVIKSSPQCICSAVNSPIPNIGLNINRTQALQLPNACNIQTPPLTQCNAATGPTAQPPAPSPTEKTPDVTLTPTSLPGARSGVGGGSKTVPSVGTGSSSRNVDPLPLHFLMFAVLVVCTSSFL

Gene Information

Entrez Gene ID
Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031225 TAS:TAIR C anchored component of membrane
GO:0008289 IEA:InterPro F lipid binding
GO:0008233 IEA:UniProtKB-KW F peptidase activity
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Protein Entry
Q7EB72_ARATH
UniProt ID
Species
Arabidopsis

Identical and Related Proteins

Unique RefSeq proteins for LMP011070 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
18407534 RefSeq NP_566126 183 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein

Identical Sequences to LMP011070 proteins

Reference Database Accession Length Protein Name
GI:18407534 DBBJ BAE73263.1 183 xylogen like protein 7 [Arabidopsis thaliana]
GI:18407534 GenBank AAL38887.1 183 unknown protein [Arabidopsis thaliana]
GI:18407534 GenBank AAM51353.1 183 unknown protein [Arabidopsis thaliana]
GI:18407534 GenBank AEC10943.1 183 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein [Arabidopsis thaliana]
GI:18407534 PIR - 183 hypothetical protein At2g48130 [imported] - Arabidopsis thaliana [Arabidopsis thaliana]

Related Sequences to LMP011070 proteins

Reference Database Accession Length Protein Name
GI:18407534 GenBank AAM64723.1 183 unknown [Arabidopsis thaliana]
GI:18407534 GenBank EFH56606.1 183 hypothetical protein ARALYDRAFT_322456 [Arabidopsis lyrata subsp. lyrata]
GI:18407534 GenBank KFK37567.1 188 hypothetical protein AALP_AA4G273500 [Arabis alpina]
GI:18407534 RefSeq XP_002880347.1 183 hypothetical protein ARALYDRAFT_322456 [Arabidopsis lyrata subsp. lyrata]
GI:18407534 RefSeq XP_010507803.1 183 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Camelina sativa]
GI:18407534 RefSeq XP_010497021.1 183 PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Camelina sativa]