Gene/Proteome Database (LMPD)
Proteins
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein | |
---|---|
Refseq ID | NP_566126 |
Protein GI | 18407534 |
UniProt ID | Q7EB72 |
mRNA ID | NM_130380 |
Length | 183 |
RefSeq Status | REVIEWED |
MGYRRSYAITFVALVAALWSVTKAQPSSSCVSTLTTLSPCLSYITGNSTTPSQPCCSRLDSVIKSSPQCICSAVNSPIPNIGLNINRTQALQLPNACNIQTPPLTQCNAATGPTAQPPAPSPTEKTPDVTLTPTSLPGARSGVGGGSKTVPSVGTGSSSRNVDPLPLHFLMFAVLVVCTSSFL |
Gene Information
Entrez Gene ID
Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0031225 | TAS:TAIR | C | anchored component of membrane |
GO:0008289 | IEA:InterPro | F | lipid binding |
GO:0008233 | IEA:UniProtKB-KW | F | peptidase activity |
GO:0006869 | IEA:InterPro | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protease inhibitor/seed storage/lipid transfer protein (LTP) family protein
Protein Entry
Q7EB72_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP011070 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
18407534 | RefSeq | NP_566126 | 183 | protease inhibitor/seed storage/lipid transfer protein (LTP) family protein |
Identical Sequences to LMP011070 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18407534 | DBBJ | BAE73263.1 | 183 | xylogen like protein 7 [Arabidopsis thaliana] |
GI:18407534 | GenBank | AAL38887.1 | 183 | unknown protein [Arabidopsis thaliana] |
GI:18407534 | GenBank | AAM51353.1 | 183 | unknown protein [Arabidopsis thaliana] |
GI:18407534 | GenBank | AEC10943.1 | 183 | protease inhibitor/seed storage/lipid transfer protein (LTP) family protein [Arabidopsis thaliana] |
GI:18407534 | PIR | - | 183 | hypothetical protein At2g48130 [imported] - Arabidopsis thaliana [Arabidopsis thaliana] |
Related Sequences to LMP011070 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:18407534 | GenBank | AAM64723.1 | 183 | unknown [Arabidopsis thaliana] |
GI:18407534 | GenBank | EFH56606.1 | 183 | hypothetical protein ARALYDRAFT_322456 [Arabidopsis lyrata subsp. lyrata] |
GI:18407534 | GenBank | KFK37567.1 | 188 | hypothetical protein AALP_AA4G273500 [Arabis alpina] |
GI:18407534 | RefSeq | XP_002880347.1 | 183 | hypothetical protein ARALYDRAFT_322456 [Arabidopsis lyrata subsp. lyrata] |
GI:18407534 | RefSeq | XP_010507803.1 | 183 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Camelina sativa] |
GI:18407534 | RefSeq | XP_010497021.1 | 183 | PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Camelina sativa] |