Gene/Proteome Database (LMPD)
Proteins
| protease inhibitor/seed storage/lipid transfer protein family protein | |
|---|---|
| Refseq ID | NP_177530 |
| Protein GI | 15219578 |
| UniProt ID | Q9C9B1 |
| mRNA ID | NM_106049 |
| Length | 193 |
| RefSeq Status | REVIEWED |
| MASSTLLITLLISLSAFFLRMVLAQVPATCASRLLSLAPCGPFVQGFAQLPAQPCCDSLNQIYSQEATCLCLFLNNTSTLSPAFPINQTLALQLPPLCNIPANSSTCSSSFPGEAPSDSSSVAPPPSSSTGSQISQGAKNNSRVAATPVAQMAPRPTSFMGLGYGLKSSGSKSEIQLTIFALAAILPAALLLI | |
Gene Information
Entrez Gene ID
Gene Name
protease inhibitor/seed storage/lipid transfer protein family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031225 | TAS:TAIR | C | anchored component of membrane |
| GO:0008233 | IEA:UniProtKB-KW | F | peptidase activity |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR016140 | Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain |
UniProt Annotations
Entry Information
Gene Name
protease inhibitor/seed storage/lipid transfer protein family protein
Protein Entry
Q9C9B1_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP011075 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15219578 | RefSeq | NP_177530 | 193 | protease inhibitor/seed storage/lipid transfer protein family protein |
Identical Sequences to LMP011075 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15219578 | GenBank | AAG52526.1 | 193 | hypothetical protein; 84520-85275 [Arabidopsis thaliana] |
| GI:15219578 | GenBank | AEE35522.1 | 193 | protease inhibitor/seed storage/lipid transfer protein family protein [Arabidopsis thaliana] |
Related Sequences to LMP011075 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15219578 | GenBank | EFH65209.1 | 196 | hypothetical protein ARALYDRAFT_339589 [Arabidopsis lyrata subsp. lyrata] |
| GI:15219578 | GenBank | EOA34395.1 | 204 | hypothetical protein CARUB_v10021923mg [Capsella rubella] |
| GI:15219578 | GenBank | ESQ27780.1 | 196 | hypothetical protein EUTSA_v10019767mg [Eutrema salsugineum] |
| GI:15219578 | RefSeq | XP_002888950.1 | 196 | hypothetical protein ARALYDRAFT_339589 [Arabidopsis lyrata subsp. lyrata] |
| GI:15219578 | RefSeq | XP_006301497.1 | 204 | hypothetical protein CARUB_v10021923mg [Capsella rubella] |
| GI:15219578 | RefSeq | XP_006390494.1 | 196 | hypothetical protein EUTSA_v10019767mg [Eutrema salsugineum] |