Gene/Proteome Database (LMPD)
LMPD ID
LMP011161
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Synonyms
F4I1.10
Alternate Names
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Chromosome
2
Proteins
| bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein | |
|---|---|
| Refseq ID | NP_181958 |
| Protein GI | 15224862 |
| UniProt ID | O64864 |
| mRNA ID | NM_129993 |
| Length | 205 |
| RefSeq Status | REVIEWED |
| MESRKIKVMATAIALIMVAMVVDAAGADKGKDKEECTAQLVGMATCLPYVQGKAKSPTPDCCSGLKQVINSDMKCLCMIIQERNDPDLGLQVNVSLALALPSVCHATADITKCPALLHLDPNSPDAQVFYQLAKGLNETVSASAPTGSASEPTSMSSTPGSSAGNNSGRTTSVPGTNHAQSFSKQWLGLEVVAHFFVIFYIFILV | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031225 | TAS:TAIR | C | anchored component of membrane |
| GO:0005886 | IDA:TAIR | C | plasma membrane |
| GO:0008289 | IEA:InterPro | F | lipid binding |
| GO:0006869 | IEA:InterPro | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein
Protein Entry
YLS3_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Up-regulated in leaves during natural senescence. {ECO:0000269|PubMed:21558309}. |
| Induction | By abscisic acid (ABA). {ECO:0000269|PubMed:21558309}. |
| Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
| Tissue Specificity | Expressed in leaves, stems, cauline leaves and sepals. Expressed at low levels in roots. {ECO:0000269|PubMed:21558309}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011161 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15224862 | RefSeq | NP_181958 | 205 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein |
Identical Sequences to LMP011161 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15224862 | DBBJ | BAC42777.1 | 205 | putative non-specific lipid transfer protein nLTP [Arabidopsis thaliana] |
| GI:15224862 | DBBJ | BAE73265.1 | 205 | xylogen like protein 9 [Arabidopsis thaliana] |
| GI:15224862 | GenBank | AAO63932.1 | 205 | unknown protein [Arabidopsis thaliana] |
| GI:15224862 | GenBank | AEC10404.1 | 205 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:15224862 | gnl | TIGR | 205 | unknown protein [Arabidopsis thaliana] |
| GI:15224862 | SwissProt | O64864.1 | 205 | RecName: Full=Protein YLS3; AltName: Full=Protein YELLOW-LEAF-SPECIFIC GENE 3; AltName: Full=Xylogen-like protein 9; Short=AtXYLP9; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP011161 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15224862 | DBBJ | BAE73266.1 | 204 | xylogen like protein 10 [Arabidopsis thaliana] |
| GI:15224862 | GenBank | AAP12845.1 | 204 | At2g44300 [Arabidopsis thaliana] |
| GI:15224862 | GenBank | AEC10405.1 | 204 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:15224862 | gnl | TIGR | 204 | unknown protein [Arabidopsis thaliana] |
| GI:15224862 | RefSeq | NP_181959.1 | 204 | bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein [Arabidopsis thaliana] |
| GI:15224862 | RefSeq | XP_010508309.1 | 204 | PREDICTED: protein YLS3-like [Camelina sativa] |