Gene/Proteome Database (LMPD)
Proteins
| putative clathrin assembly protein | |
|---|---|
| Refseq ID | NP_683306 |
| Protein GI | 22329559 |
| UniProt ID | Q9LQW4 |
| mRNA ID | NM_148465 |
| Length | 339 |
| RefSeq Status | REVIEWED |
| MKLWKRAAVVLKDGPSLIAADDILTAAVVKATSHDELSIDTESAQFIYRHVLSSPSSLKPLVSLISSRVKRTRSWAVALKGLMLMHGFFLCKSTVAESIGRLPFDLSSFGEGNSRIMSKSGGFNLFVRAYFAFLDRRSILFHDGNRHRYNEESSVLIRLVIIRKMQIIVDSLIRIKPIGENMMIPVINEAMENVVSEIMEIYGWICRRIAEVLPNVHSKIGKTEADLALKIVAKSMKQGGELKKYFEFCKDLGVSNAQEIPNFVRIPEADVIHLDELVRTAMESSEESAERTEIAEEEEEEEEEIETKLSDLITLDHNEEAPASPPRVVVVDIPDLISF | |
Gene Information
Entrez Gene ID
Gene Name
putative clathrin assembly protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0030118 | IEA:InterPro | C | clathrin coat |
| GO:0005905 | IEA:UniProtKB-KW | C | coated pit |
| GO:0031410 | IEA:UniProtKB-KW | C | cytoplasmic vesicle |
| GO:0005545 | IEA:InterPro | F | 1-phosphatidylinositol binding |
| GO:0048268 | IEA:InterPro | P | clathrin coat assembly |
| GO:0006897 | IEA:UniProtKB-KW | P | endocytosis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
putative clathrin assembly protein
Protein Entry
CAP15_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Similarity | Contains 1 ENTH (epsin N-terminal homology) domain. {ECO:0000255|PROSITE-ProRule:PRU00243}. |
| Subcellular Location | Membrane, clathrin-coated pit {ECO:0000250}. Golgi apparatus {ECO:0000250}. Cytoplasmic vesicle, clathrin- coated vesicle {ECO:0000250}. Note=Colocalized with clathrin in the Golgi area. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011176 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 22329559 | RefSeq | NP_683306 | 339 | putative clathrin assembly protein |
Identical Sequences to LMP011176 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22329559 | GenBank | AAF79250.1 | 339 | F10B6.6 [Arabidopsis thaliana] |
| GI:22329559 | GenBank | AEE29205.1 | 339 | putative clathrin assembly protein [Arabidopsis thaliana] |
| GI:22329559 | SwissProt | Q9LQW4.1 | 339 | RecName: Full=Putative clathrin assembly protein At1g14686 [Arabidopsis thaliana] |
Related Sequences to LMP011176 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22329559 | GenBank | EFH69080.1 | 341 | hypothetical protein ARALYDRAFT_888852 [Arabidopsis lyrata subsp. lyrata] |
| GI:22329559 | GenBank | EOA38790.1 | 343 | hypothetical protein CARUB_v10011056mg [Capsella rubella] |
| GI:22329559 | RefSeq | XP_002892821.1 | 341 | hypothetical protein ARALYDRAFT_888852 [Arabidopsis lyrata subsp. lyrata] |
| GI:22329559 | RefSeq | XP_006305892.1 | 343 | hypothetical protein CARUB_v10011056mg [Capsella rubella] |
| GI:22329559 | RefSeq | XP_010496407.1 | 345 | PREDICTED: putative clathrin assembly protein At1g14686 [Camelina sativa] |
| GI:22329559 | RefSeq | XP_010476534.1 | 345 | PREDICTED: putative clathrin assembly protein At1g14686 [Camelina sativa] |