Gene/Proteome Database (LMPD)

LMPD ID
LMP011209
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
protease inhibitor/seed storage/LTP family protein
Gene Symbol
Alternate Names
protease inhibitor/seed storage/LTP family protein
Chromosome
5

Proteins

protease inhibitor/seed storage/LTP family protein
Refseq ID NP_001078780
Protein GI 145334869
UniProt ID Q9FIT2
mRNA ID NM_001085311
Length 120
RefSeq Status REVIEWED
MTRSFSPVVSLFLLLLQTICSATVENAADCAAVGTLISSCTEFVNYGYPDPIPGSSCCDAMTVIGTYSDSSEKRKWLCNCFMDLINVYNSNATAISTLSGFCGVVLGFTIDPNTDCNFIQ

Gene Information

Entrez Gene ID
Gene Name
protease inhibitor/seed storage/LTP family protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:InterPro P lipid transport

Domain Information

InterPro Annotations

Accession Description
IPR016140 Bifunctional inhibitor/plant lipid transfer protein/seed storage helical domain
IPR000528 Plant lipid transfer protein/Par allergen

UniProt Annotations

Entry Information

Gene Name
protease inhibitor/seed storage/LTP family protein
Protein Entry
NLTPE_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Function Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}.
Sequence Caution Sequence=BAB10168.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Similarity Belongs to the plant LTP family. {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011209 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
145334869 RefSeq NP_001078780 120 protease inhibitor/seed storage/LTP family protein

Identical Sequences to LMP011209 proteins

Reference Database Accession Length Protein Name
GI:145334869 gnl TAIR 120 protease inhibitor/seed storage/LTP family protein [Arabidopsis thaliana]
GI:145334869 SwissProt Q9FIT2.2 120 RecName: Full=Putative non-specific lipid-transfer protein 14; Short=LTP 14; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011209 proteins

Reference Database Accession Length Protein Name
GI:145334869 DBBJ BAB10168.1 118 unnamed protein product [Arabidopsis thaliana]
GI:145334869 GenBank EFH41030.1 120 lipid binding protein [Arabidopsis lyrata subsp. lyrata]
GI:145334869 GenBank EOA12416.1 122 hypothetical protein CARUB_v10027812mg [Capsella rubella]
GI:145334869 RefSeq XP_002864771.1 120 lipid binding protein [Arabidopsis lyrata subsp. lyrata]
GI:145334869 RefSeq XP_006279518.1 122 hypothetical protein CARUB_v10027812mg [Capsella rubella]
GI:145334869 RefSeq XP_010458204.1 122 PREDICTED: putative non-specific lipid-transfer protein 14 [Camelina sativa]