Gene/Proteome Database (LMPD)
Proteins
| protease inhibitor/seed storage/LTP family protein | |
|---|---|
| Refseq ID | NP_001078780 |
| Protein GI | 145334869 |
| UniProt ID | Q9FIT2 |
| mRNA ID | NM_001085311 |
| Length | 120 |
| RefSeq Status | REVIEWED |
| MTRSFSPVVSLFLLLLQTICSATVENAADCAAVGTLISSCTEFVNYGYPDPIPGSSCCDAMTVIGTYSDSSEKRKWLCNCFMDLINVYNSNATAISTLSGFCGVVLGFTIDPNTDCNFIQ | |
Gene Information
Entrez Gene ID
Gene Name
protease inhibitor/seed storage/LTP family protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0006869 | IEA:InterPro | P | lipid transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
protease inhibitor/seed storage/LTP family protein
Protein Entry
NLTPE_ARATH
UniProt ID
Species
Arabidopsis
Comments
| Comment Type | Description |
|---|---|
| Function | Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues (By similarity). {ECO:0000250}. |
| Sequence Caution | Sequence=BAB10168.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the plant LTP family. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011209 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 145334869 | RefSeq | NP_001078780 | 120 | protease inhibitor/seed storage/LTP family protein |
Identical Sequences to LMP011209 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145334869 | gnl | TAIR | 120 | protease inhibitor/seed storage/LTP family protein [Arabidopsis thaliana] |
| GI:145334869 | SwissProt | Q9FIT2.2 | 120 | RecName: Full=Putative non-specific lipid-transfer protein 14; Short=LTP 14; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP011209 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:145334869 | DBBJ | BAB10168.1 | 118 | unnamed protein product [Arabidopsis thaliana] |
| GI:145334869 | GenBank | EFH41030.1 | 120 | lipid binding protein [Arabidopsis lyrata subsp. lyrata] |
| GI:145334869 | GenBank | EOA12416.1 | 122 | hypothetical protein CARUB_v10027812mg [Capsella rubella] |
| GI:145334869 | RefSeq | XP_002864771.1 | 120 | lipid binding protein [Arabidopsis lyrata subsp. lyrata] |
| GI:145334869 | RefSeq | XP_006279518.1 | 122 | hypothetical protein CARUB_v10027812mg [Capsella rubella] |
| GI:145334869 | RefSeq | XP_010458204.1 | 122 | PREDICTED: putative non-specific lipid-transfer protein 14 [Camelina sativa] |