Gene/Proteome Database (LMPD)
Proteins
| S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | |
|---|---|
| Refseq ID | NP_188988 |
| Protein GI | 42565135 |
| UniProt ID | F4J432 |
| mRNA ID | NM_113249 |
| Length | 305 |
| RefSeq Status | REVIEWED |
| MVTPMSNRKHMVMSLIEKAARFFFTRFLTHFISTGCVTIFEGGNMVTFEGKDSRCHLKSELEIHSPQFYWKVMTQVDLGLADAYINGDFSFVNKETGLLNLIMILIASKELNSNLAEKRGRWTPIFLTTGLSSAKHFLKHLYRQNNLTQARRNISRHYDLSNELFTIFLDDTMSYSSGVFKSDDEELKIAQMRKIYLLIEKTAYLSCSIENVENIGIHYYQTLRLWRKNFFERQKQITDLGFDDRFVRTCEYYFDYCAAGFKTRTVGDYQIVFSRPGNVIALGDDSFYSSPLTQKKQLQMNHFDS | |
Gene Information
Entrez Gene ID
Gene Name
S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0009507 | IDA:TAIR | C | chloroplast |
| GO:0008168 | IEA:UniProtKB-KW | F | methyltransferase activity |
| GO:0008610 | IEA:InterPro | P | lipid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Protein Entry
F4J432_ARATH
UniProt ID
Species
Arabidopsis
Identical and Related Proteins
Unique RefSeq proteins for LMP011250 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 42565135 | RefSeq | NP_188988 | 305 | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein |
Identical Sequences to LMP011250 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42565135 | GenBank | AEE76767.1 | 305 | S-adenosyl-L-methionine-dependent methyltransferases superfamily protein [Arabidopsis thaliana] |
Related Sequences to LMP011250 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:42565135 | DBBJ | BAB02290.1 | 257 | unnamed protein product [Arabidopsis thaliana] |
| GI:42565135 | GenBank | ESQ47479.1 | 855 | hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum] |
| GI:42565135 | RefSeq | XP_006406026.1 | 855 | hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum] |
| GI:42565135 | RefSeq | XP_010466683.1 | 440 | PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 2 isoform X1 [Camelina sativa] |
| GI:42565135 | RefSeq | XP_010466684.1 | 434 | PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 2 isoform X2 [Camelina sativa] |
| GI:42565135 | RefSeq | XP_010466685.1 | 428 | PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 2 isoform X3 [Camelina sativa] |