Gene/Proteome Database (LMPD)

LMPD ID
LMP011290
Gene ID
838275
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
solanesyl diphosphate synthase 2
Gene Symbol
SPS2
Synonyms
F20D23.25; F20D23_25; solanesyl diphosphate synthase 2; SPS2
Alternate Names
solanesyl diphosphate synthase 2
Chromosome
1
EC Number
2.5.1.85
Summary
Encodes a protein with solanesyl diphosphate synthase activity.
Orthologs
View orthologs and multiple alignments for SPS2

Proteins

solanesyl diphosphate synthase 2
Refseq ID NP_173148
Protein GI 22329620
UniProt ID Q76FS5
mRNA ID NM_101565
Length 417
RefSeq Status REVIEWED
MMMSCRNIDLGTSVLDHSCSSSSTSRRFLFGNSSKTVCMIGGRSCVGNLVFLRRDLATCRAVPAKSKENSLVNGIGQDQTVMLNLRQESRKPISLETLFEVVADDLQRLNDNLLSIVGAENPVLISAAEQIFSAGGKRMRPGLVFLVSRATAELAGLKELTVEHRRLGEIIEMIHTASLIHDDVLDESDMRRGRETVHELFGTRVAVLAGDFMFAQASWYLANLENLEVIKLISQVIKDFASGEIKQASSLFDCDVKLDDYMLKSYYKTASLVAASTKGAAIFSKVESKVAEQMYQFGKNLGLSFQVVDDILDFTQSTEQLGKPAANDLAKGNITAPVIFALENEPRLREIIESEFCEPGSLEEAIEIVRNRGGIKKAQELAKEKAELALKNLNCLPRSGFRSALEDMVMFNLERID

Gene Information

Entrez Gene ID
838275
Gene Name
solanesyl diphosphate synthase 2
Gene Symbol
SPS2
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009507 IDA:TAIR C chloroplast
GO:0009570 IDA:TAIR C chloroplast stroma
GO:0009536 IDA:TAIR C plastid
GO:0052924 IEA:UniProtKB-EC F all-trans-nonaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0050347 IGI:TAIR F trans-octaprenyltranstransferase activity
GO:0008299 IEA:UniProtKB-KW P isoprenoid biosynthetic process
GO:0015979 IEA:InterPro P photosynthesis
GO:0010236 IMP:TAIR P plastoquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath01110 Biosynthesis of secondary metabolites
ath00900 Terpenoid backbone biosynthesis
ko00900 Terpenoid backbone biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5807 heptaprenyl diphosphate biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR008949 Isoprenoid synthase domain
IPR000092 Polyprenyl synthetase
IPR017446 Polyprenyl synthetase-related
IPR014120 Solanesyl diphosphate synthase

UniProt Annotations

Entry Information

Gene Name
solanesyl diphosphate synthase 2
Protein Entry
SPS2_ARATH
UniProt ID
Q76FS5
Species
Arabidopsis

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=6.89 uM for farnesyl diphosphate (in the presence of 500 uM of isopentenyl diphosphate) {ECO:0000269|PubMed:15784989}; KM=0.843 uM for geranylgeranyl diphosphate (in the presence of 100 uM of isopentenyl diphosphate) {ECO:0000269|PubMed:15784989}; KM=182 uM for isopentenyl diphosphate (in the presence of 20 uM of farnesyl diphosphate) {ECO:0000269|PubMed:15784989}; KM=28.9 uM for isopentenyl diphosphate (in the presence of 4 uM of geranylgeranyl diphosphate) {ECO:0000269|PubMed:15784989}; Note=kcat is 3.77 sec(-1) with farnesyl diphosphate as substrate (in the presence of 500 uM of isopentenyl diphosphate). kcat is 2.33 sec(-1) with geranylgeranyl diphosphate as substrate (in the presence of 100 uM of isopentenyl diphosphate). kcat is 2.83 sec(-1) with isopentenyl diphosphate as substrate (in the presence of 20 uM of farnesyl diphosphate). kcat is 1.72 sec(-1) with isopentenyl diphosphate as substrate (in the presence of 4 uM of geranylgeranyl diphosphate).; pH dependence: Optimum pH is 8.0. {ECO:0000269|PubMed:15784989};
Catalytic Activity Geranylgeranyl diphosphate + 5 isopentenyl diphosphate = 5 diphosphate + all-trans-nonaprenyl diphosphate. {ECO:0000269|PubMed:15784989}.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000250}; Note=Binds 3 Mg(2+) ions per subunit. {ECO:0000250};
Function Involved in providing solanesyl diphosphate for plastoquinone-9 formation. Prefers geranylgeranyl diphosphate to farnesyl diphosphate as substrate. No activity with geranyl diphosphate or dimethylallyl diphosphate as substrate. {ECO:0000269|PubMed:15653808, ECO:0000269|PubMed:15784989}.
Sequence Caution Sequence=AAD50025.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Similarity Belongs to the FPP/GGPP synthase family. {ECO:0000305}.
Subcellular Location Plastid, chloroplast {ECO:0000269|PubMed:15653808, ECO:0000269|PubMed:15784989}.
Subunit Homodimer. {ECO:0000250}.
Tissue Specificity Higher expression in leaves than in roots. {ECO:0000269|PubMed:15784989}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011290 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22329620 RefSeq NP_173148 417 solanesyl diphosphate synthase 2

Identical Sequences to LMP011290 proteins

Reference Database Accession Length Protein Name
GI:22329620 DBBJ BAC82428.1 417 solanesyl diphosphate synthase [Arabidopsis thaliana]
GI:22329620 DBBJ BAD88534.1 417 solanesyl diphosphate synthase 2 [Arabidopsis thaliana]
GI:22329620 GenBank ABI54337.1 417 At1g17050 [Arabidopsis thaliana]
GI:22329620 GenBank AEE29535.1 417 solanesyl diphosphate synthase 2 [Arabidopsis thaliana]
GI:22329620 SwissProt Q76FS5.1 417 RecName: Full=Solanesyl diphosphate synthase 2, chloroplastic; Short=AtSPS2; AltName: Full=All-trans-nonaprenyl-diphosphate synthase 2 (geranylgeranyl-diphosphate specific); Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011290 proteins

Reference Database Accession Length Protein Name
GI:22329620 GenBank EFH44985.1 417 hypothetical protein ARALYDRAFT_494049 [Arabidopsis lyrata subsp. lyrata]
GI:22329620 GenBank EOA40503.1 424 hypothetical protein CARUB_v10009229mg [Capsella rubella]
GI:22329620 RefSeq XP_002868726.1 417 hypothetical protein ARALYDRAFT_494049 [Arabidopsis lyrata subsp. lyrata]
GI:22329620 RefSeq XP_006307605.1 424 hypothetical protein CARUB_v10009229mg [Capsella rubella]
GI:22329620 RefSeq XP_010459265.1 421 PREDICTED: solanesyl diphosphate synthase 2, chloroplastic-like [Camelina sativa]
GI:22329620 RefSeq XP_010476839.1 422 PREDICTED: solanesyl diphosphate synthase 2, chloroplastic-like [Camelina sativa]