Gene/Proteome Database (LMPD)
LMPD ID
LMP011316
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
sterol 14-demethylase
Gene Symbol
Synonyms
CYP51; CYP51A2; CYP51G1; CYTOCHROME P450 51; CYTOCHROME P450 51A2; CYTOCHROME P450 51G1; EMB1738; embryo defective 1738; F25C20.17; F25C20_17
Alternate Names
sterol 14-demethylase
Chromosome
1
EC Number
1.14.13.70
Summary
putative obtusifoliol 14-alpha demethylase involved in sterol biosynthesis.
Orthologs
Proteins
| sterol 14-demethylase | |
|---|---|
| Refseq ID | NP_172633 |
| Protein GI | 15221075 |
| UniProt ID | Q9SAA9 |
| mRNA ID | NM_101040 |
| Length | 488 |
| RefSeq Status | REVIEWED |
| MELDSENKLLKTGLVIVATLVIAKLIFSFFTSDSKKKRLPPTLKAWPPLVGSLIKFLKGPIIMLREEYPKLGSVFTVNLVHKKITFLIGPEVSAHFFKASESDLSQQEVYQFNVPTFGPGVVFDVDYSVRQEQFRFFTEALRVNKLKGYVDMMVTEAEDYFSKWGESGEVDIKVELERLIILTASRCLLGREVRDQLFDDVSALFHDLDNGMLPISVLFPYLPIPAHRRRDRAREKLSEIFAKIIGSRKRSGKTENDMLQCFIESKYKDGRQTTESEVTGLLIAALFAGQHTSSITSTWTGAYLMRYKEYFSAALDEQKNLIAKHGDKIDHDILSEMDVLYRCIKEALRLHPPLIMLMRASHSDFSVTARDGKTYDIPKGHIVATSPAFANRLPHIFKDPDTYDPERFSPGREEDKAAGAFSYIAFGGGRHGCLGEPFAYLQIKAIWSHLLRNFELELVSPFPEIDWNAMVVGVKGNVMVRYKRRQLS | |
Gene Information
Entrez Gene ID
Gene Name
sterol 14-demethylase
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IDA:TAIR | C | Golgi apparatus |
| GO:0005783 | IDA:TAIR | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IDA:TAIR | C | plasma membrane |
| GO:0020037 | IEA:InterPro | F | heme binding |
| GO:0005506 | IEA:InterPro | F | iron ion binding |
| GO:0008168 | IEA:UniProtKB-KW | F | methyltransferase activity |
| GO:0008398 | TAS:TAIR | F | sterol 14-demethylase activity |
| GO:0070988 | TAS:GOC | P | demethylation |
| GO:0016126 | IMP:TAIR | P | sterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath01110 | Biosynthesis of secondary metabolites |
| ath01100 | Metabolic pathways |
| ath00100 | Steroid biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6254036 | Cholesterol biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A 14-alpha-methylsteroid + 3 O(2) + 3 NADPH = a Delta(14)-steroid + formate + 3 NADP(+) + 4 H(2)O. {ECO:0000269|PubMed:11437378, ECO:0000269|PubMed:16040657}. |
| Cofactor | Name=heme; Xref=ChEBI:CHEBI:30413; |
| Disruption Phenotype | Lack of membrane integrity. Seedling lethality. {ECO:0000269|PubMed:15266054, ECO:0000269|PubMed:16040657, ECO:0000269|PubMed:16169959}. |
| Function | Involved in sterol biosynthesis. Catalyzes the 14-alpha demethylation of obtusifoliol to 4 alpha-methyl-5 alpha-ergosta- 8,14,24(28)-trien-3 beta-ol. {ECO:0000269|PubMed:11437378, ECO:0000269|PubMed:16040657, ECO:0000269|PubMed:16169959}. |
| Miscellaneous | Decreased expression of CYP51G1 by antisense leads to a semidwarf phenotype in the early growth stage and a longer life span. Disruption mutants accumulate obtusifoliol and 14- alpha-methyl-sterols and cannot be rescued by exogenous application of brassinosteroids. |
| Similarity | Belongs to the cytochrome P450 family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Expressed in leaves, roots, stems, siliques, flowers, flower buds and seedlings. {ECO:0000269|PubMed:16040657}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011316 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15221075 | RefSeq | NP_172633 | 488 | sterol 14-demethylase |
Identical Sequences to LMP011316 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221075 | GenBank | ACV99104.1 | 488 | Sequence 17 from patent US 7544863 |
| GI:15221075 | GenBank | ACV99105.1 | 488 | Sequence 19 from patent US 7544863 |
| GI:15221075 | GenBank | AED65467.1 | 488 | Sequence 17 from patent US 7906710 |
| GI:15221075 | GenBank | AED65468.1 | 488 | Sequence 19 from patent US 7906710 |
| GI:15221075 | GenBank | AEE28769.1 | 488 | sterol 14-demethylase [Arabidopsis thaliana] |
| GI:15221075 | GenBank | AEL93556.1 | 488 | Sequence 173 from patent US 7982096 |
Related Sequences to LMP011316 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15221075 | GenBank | EFH66146.1 | 488 | CYP51G1 [Arabidopsis lyrata subsp. lyrata] |
| GI:15221075 | GenBank | EOA40253.1 | 488 | hypothetical protein CARUB_v10008973mg [Capsella rubella] |
| GI:15221075 | RefSeq | XP_002889887.1 | 488 | CYP51G1 [Arabidopsis lyrata subsp. lyrata] |
| GI:15221075 | RefSeq | XP_006307355.1 | 488 | hypothetical protein CARUB_v10008973mg [Capsella rubella] |
| GI:15221075 | RefSeq | XP_010493161.1 | 488 | PREDICTED: sterol 14-demethylase-like [Camelina sativa] |
| GI:15221075 | RefSeq | XP_010476102.1 | 488 | PREDICTED: sterol 14-demethylase [Camelina sativa] |