Gene/Proteome Database (LMPD)

LMPD ID
LMP011396
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
transcription factor TCP14
Gene Symbol
Synonyms
AtTCP14; cycloidea and PCF (TCP) 14; TCP14; TEOSINTE BRANCHED
Alternate Names
transcription factor TCP14
Chromosome
3
Summary
Encodes a transcription factor AtTCP14 that regulates seed germination. AtTCP14 shows elevated expression level just prior to germination. AtTCP14 is predominantly expressed in the vascular tissue of the embryo, and affects gene expression in radicles in a non-cell-autonomous manner.
Orthologs

Proteins

transcription factor TCP14
Refseq ID NP_190346
Protein GI 22331641
UniProt ID Q93Z00
mRNA ID NM_114630
Length 489
RefSeq Status REVIEWED
MQKPTSSILNVIMDGGDSVGGGGGDDHHRHLHHHHRPTFPFQLLGKHDPDDNHQQQPSPSSSSSLFSLHQHQQLSQSQPQSQSQKSQPQTTQKELLQTQEESAVVAAKKPPLKRASTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPSVIAATGTGTIPANFTSLNISLRSSGSSMSLPSHFRSAASTFSPNNIFSPAMLNQQQRGGGVGFHHPHLQGRAPTSSLFPGIDNFTPTTSFLNFHNPTKQEGDQDSEELNSEKKRRIQTTSDLHNQHQHDQIGGYTLQSSNSGSTATAAAAQQIPGNFWMVAAAAAAGGGGGNNNQTGGLMTASIGTGGGGGEPVWTFPSINTAAAALYRSGVSGVPSGAVSSGLHFMNFAAPMAFLTGQQQLATTSNHEINEDSNNNEGGRSDGGGDHHNTQRHHHHQQQHHHNILSGLNQYGRQVSGDSQASGSLGGGDEEDQQD

Gene Information

Entrez Gene ID
Gene Name
transcription factor TCP14
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005634 IDA:TAIR C nucleus
GO:0003677 IEA:UniProtKB-KW F DNA binding
GO:0003700 ISS:TAIR F sequence-specific DNA binding transcription factor activity
GO:0008283 IGI:TAIR P cell proliferation
GO:0010229 IGI:TAIR P inflorescence development
GO:0031347 IMP:TAIR P regulation of defense response
GO:0010029 IEP:TAIR P regulation of seed germination
GO:0006355 TAS:TAIR P regulation of transcription, DNA-templated
GO:0009737 IMP:TAIR P response to abscisic acid
GO:0009735 IMP:TAIR P response to cytokinin
GO:0009739 IMP:TAIR P response to gibberellin
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated

Domain Information

InterPro Annotations

Accession Description
IPR017887 Transcription factor TCP subgroup
IPR005333 Transcription factor, TCP

UniProt Annotations

Entry Information

Gene Name
transcription factor TCP14
Protein Entry
TCP14_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Interaction Q9SLK2:ALIS3; NbExp=2; IntAct=EBI-4424563, EBI-4463103; Q9FK45:At5g18260; NbExp=2; IntAct=EBI-4424563, EBI-4470510; Q9S7W5:TCP13; NbExp=3; IntAct=EBI-4424563, EBI-4424877;
Sequence Caution Sequence=CAB61988.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Contains 1 TCP domain. {ECO:0000255|PROSITE- ProRule:PRU00701}.
Subcellular Location Nucleus {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011396 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22331641 RefSeq NP_190346 489 transcription factor TCP14

Identical Sequences to LMP011396 proteins

Reference Database Accession Length Protein Name
GI:22331641 EMBL CCF77151.1 489 unnamed protein product [Arabidopsis thaliana]
GI:22331641 GenBank AEE78308.1 489 transcription factor TCP14 [Arabidopsis thaliana]
GI:22331641 GenBank AEQ40359.1 489 Sequence 796 from patent US 8030546
GI:22331641 GenBank AFC08147.1 489 Sequence 220 from patent US 8110725
GI:22331641 GenBank AGM80133.1 489 Sequence 220 from patent US 8426678
GI:22331641 GenBank AHE22411.1 489 Sequence 22 from patent US 8575421

Related Sequences to LMP011396 proteins

Reference Database Accession Length Protein Name
GI:22331641 EMBL CAB61988.1 477 putative protein [Arabidopsis thaliana]
GI:22331641 GenBank EOA23827.1 512 hypothetical protein CARUB_v10017043mg [Capsella rubella]
GI:22331641 RefSeq XP_006290929.1 512 hypothetical protein CARUB_v10017043mg [Capsella rubella]
GI:22331641 RefSeq XP_010503367.1 508 PREDICTED: transcription factor TCP14-like [Camelina sativa]
GI:22331641 RefSeq XP_010515068.1 511 PREDICTED: transcription factor TCP14 [Camelina sativa]
GI:22331641 RefSeq XP_010426208.1 514 PREDICTED: transcription factor TCP14-like [Camelina sativa]