Gene/Proteome Database (LMPD)
LMPD ID
LMP011396
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
transcription factor TCP14
Gene Symbol
Synonyms
AtTCP14; cycloidea and PCF (TCP) 14; TCP14; TEOSINTE BRANCHED
Alternate Names
transcription factor TCP14
Chromosome
3
Summary
Encodes a transcription factor AtTCP14 that regulates seed germination. AtTCP14 shows elevated expression level just prior to germination. AtTCP14 is predominantly expressed in the vascular tissue of the embryo, and affects gene expression in radicles in a non-cell-autonomous manner.
Orthologs
Proteins
transcription factor TCP14 | |
---|---|
Refseq ID | NP_190346 |
Protein GI | 22331641 |
UniProt ID | Q93Z00 |
mRNA ID | NM_114630 |
Length | 489 |
RefSeq Status | REVIEWED |
MQKPTSSILNVIMDGGDSVGGGGGDDHHRHLHHHHRPTFPFQLLGKHDPDDNHQQQPSPSSSSSLFSLHQHQQLSQSQPQSQSQKSQPQTTQKELLQTQEESAVVAAKKPPLKRASTKDRHTKVDGRGRRIRMPALCAARVFQLTRELGHKSDGETIEWLLQQAEPSVIAATGTGTIPANFTSLNISLRSSGSSMSLPSHFRSAASTFSPNNIFSPAMLNQQQRGGGVGFHHPHLQGRAPTSSLFPGIDNFTPTTSFLNFHNPTKQEGDQDSEELNSEKKRRIQTTSDLHNQHQHDQIGGYTLQSSNSGSTATAAAAQQIPGNFWMVAAAAAAGGGGGNNNQTGGLMTASIGTGGGGGEPVWTFPSINTAAAALYRSGVSGVPSGAVSSGLHFMNFAAPMAFLTGQQQLATTSNHEINEDSNNNEGGRSDGGGDHHNTQRHHHHQQQHHHNILSGLNQYGRQVSGDSQASGSLGGGDEEDQQD |
Gene Information
Entrez Gene ID
Gene Name
transcription factor TCP14
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005634 | IDA:TAIR | C | nucleus |
GO:0003677 | IEA:UniProtKB-KW | F | DNA binding |
GO:0003700 | ISS:TAIR | F | sequence-specific DNA binding transcription factor activity |
GO:0008283 | IGI:TAIR | P | cell proliferation |
GO:0010229 | IGI:TAIR | P | inflorescence development |
GO:0031347 | IMP:TAIR | P | regulation of defense response |
GO:0010029 | IEP:TAIR | P | regulation of seed germination |
GO:0006355 | TAS:TAIR | P | regulation of transcription, DNA-templated |
GO:0009737 | IMP:TAIR | P | response to abscisic acid |
GO:0009735 | IMP:TAIR | P | response to cytokinin |
GO:0009739 | IMP:TAIR | P | response to gibberellin |
GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
UniProt Annotations
Entry Information
Gene Name
transcription factor TCP14
Protein Entry
TCP14_ARATH
UniProt ID
Species
Arabidopsis
Comments
Comment Type | Description |
---|---|
Interaction | Q9SLK2:ALIS3; NbExp=2; IntAct=EBI-4424563, EBI-4463103; Q9FK45:At5g18260; NbExp=2; IntAct=EBI-4424563, EBI-4470510; Q9S7W5:TCP13; NbExp=3; IntAct=EBI-4424563, EBI-4424877; |
Sequence Caution | Sequence=CAB61988.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
Similarity | Contains 1 TCP domain. {ECO:0000255|PROSITE- ProRule:PRU00701}. |
Subcellular Location | Nucleus {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011396 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
22331641 | RefSeq | NP_190346 | 489 | transcription factor TCP14 |
Identical Sequences to LMP011396 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22331641 | EMBL | CCF77151.1 | 489 | unnamed protein product [Arabidopsis thaliana] |
GI:22331641 | GenBank | AEE78308.1 | 489 | transcription factor TCP14 [Arabidopsis thaliana] |
GI:22331641 | GenBank | AEQ40359.1 | 489 | Sequence 796 from patent US 8030546 |
GI:22331641 | GenBank | AFC08147.1 | 489 | Sequence 220 from patent US 8110725 |
GI:22331641 | GenBank | AGM80133.1 | 489 | Sequence 220 from patent US 8426678 |
GI:22331641 | GenBank | AHE22411.1 | 489 | Sequence 22 from patent US 8575421 |
Related Sequences to LMP011396 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22331641 | EMBL | CAB61988.1 | 477 | putative protein [Arabidopsis thaliana] |
GI:22331641 | GenBank | EOA23827.1 | 512 | hypothetical protein CARUB_v10017043mg [Capsella rubella] |
GI:22331641 | RefSeq | XP_006290929.1 | 512 | hypothetical protein CARUB_v10017043mg [Capsella rubella] |
GI:22331641 | RefSeq | XP_010503367.1 | 508 | PREDICTED: transcription factor TCP14-like [Camelina sativa] |
GI:22331641 | RefSeq | XP_010515068.1 | 511 | PREDICTED: transcription factor TCP14 [Camelina sativa] |
GI:22331641 | RefSeq | XP_010426208.1 | 514 | PREDICTED: transcription factor TCP14-like [Camelina sativa] |