Gene/Proteome Database (LMPD)
Proteins
transcription factor TT2 | |
---|---|
Refseq ID | NP_198405 |
Protein GI | 15238535 |
UniProt ID | Q9FJA2 |
mRNA ID | NM_122946 |
Length | 258 |
RefSeq Status | REVIEWED |
MGKRATTSVRREELNRGAWTDHEDKILRDYITTHGEGKWSTLPNQAGLKRCGKSCRLRWKNYLRPGIKRGNISSDEEELIIRLHNLLGNRWSLIAGRLPGRTDNEIKNHWNSNLRKRLPKTQTKQPKRIKHSTNNENNVCVIRTKAIRCSKTLLFSDLSLQKKSSTSPLPLKEQEMDQGGSSLMGDLEFDFDRIHSEFHFPDLMDFDGLDCGNVTSLVSSNEILGELVPAQGNLDLNRPFTSCHHRGDDEDWLRDFTC |
Gene Information
Entrez Gene ID
Gene Name
transcription factor TT2
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005634 | IDA:TAIR | C | nucleus |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0003682 | IEA:InterPro | F | chromatin binding |
GO:0003677 | IEA:UniProtKB-KW | F | DNA binding |
GO:0003700 | ISS:TAIR | F | sequence-specific DNA binding transcription factor activity |
GO:0006633 | IMP:TAIR | P | fatty acid biosynthetic process |
GO:0009813 | IEA:UniProtKB-KW | P | flavonoid biosynthetic process |
GO:0010023 | IMP:TAIR | P | proanthocyanidin biosynthetic process |
GO:0006970 | IMP:TAIR | P | response to osmotic stress |
GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Developmental Stage | Highly expressed from the very early stages of embryogenesis to the globular stage, decreases rapidly from the late heart-torpedo stage and did not persist after the completion of embryogenesis. |
Function | Transcription activator, when associated with BHLH2/EGL3/MYC146, BHLH12/MYC1, or BHLH42/TT8. Involved in the control of flavonoid late metabolism in developing siliques. Plays a key role in determining the tissue-specific activation of leucoanthocyanidin reductase (BANYULS). {ECO:0000269|PubMed:15361138}. |
Interaction | Q9FT81:TT8; NbExp=3; IntAct=EBI-395778, EBI-395790; |
Miscellaneous | TT2 activity is tightly linked to the presence of TT8. |
Sequence Caution | Sequence=ABK28720.1; Type=Erroneous termination; Positions=259; Note=Translated as stop.; Evidence={ECO:0000305}; |
Similarity | Contains 2 HTH myb-type DNA-binding domains. {ECO:0000255|PROSITE-ProRule:PRU00625}. |
Subcellular Location | Nucleus. |
Subunit | Interacts with BHLH2/EGL3/MYC146, BHLH12/MYC1 and BHLH42/TT8. {ECO:0000269|PubMed:15361138}. |
Tissue Specificity | Expressed at a high level in immature siliques and at a lower level in flowers. Undetected in young seedlings, roots, leaves and inflorescence stems. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011397 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15238535 | RefSeq | NP_198405 | 258 | transcription factor TT2 |
Identical Sequences to LMP011397 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15238535 | EMBL | CDH61642.1 | 258 | unnamed protein product [Arabidopsis thaliana] |
GI:15238535 | EMBL | CDH61665.1 | 258 | unnamed protein product [Arabidopsis thaliana] |
GI:15238535 | GenBank | AED37604.1 | 258 | Sequence 42 from patent US 7880059 |
GI:15238535 | GenBank | AEQ40228.1 | 258 | Sequence 534 from patent US 8030546 |
GI:15238535 | GenBank | AGM61065.1 | 258 | Sequence 17 from patent US 8420889 |
GI:15238535 | gnl | TAIR | 258 | transcription factor TT2 [Arabidopsis thaliana] |
Related Sequences to LMP011397 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15238535 | GenBank | ABK28720.1 | 259 | unknown, partial [Arabidopsis thaliana] |
GI:15238535 | GenBank | EFH44684.1 | 261 | hypothetical protein ARALYDRAFT_493616 [Arabidopsis lyrata subsp. lyrata] |
GI:15238535 | GenBank | EOA15731.1 | 263 | hypothetical protein CARUB_v10006684mg [Capsella rubella] |
GI:15238535 | RefSeq | XP_002868425.1 | 261 | hypothetical protein ARALYDRAFT_493616 [Arabidopsis lyrata subsp. lyrata] |
GI:15238535 | RefSeq | XP_010440735.1 | 261 | PREDICTED: transcription factor TT2-like [Camelina sativa] |
GI:15238535 | RefSeq | XP_010450385.1 | 261 | PREDICTED: transcription factor TT2 [Camelina sativa] |