Gene/Proteome Database (LMPD)
LMPD ID
LMP011405
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
triacylglycerol lipase 1
Gene Symbol
Synonyms
ATLIP1; F15A23.3; F15A23_3; LIP1; lipase 1
Chromosome
2
Summary
Lipase active on medium and short chain triacylglycerols, but not on phospho- or galactolipids. Active between pH4 and 7 with an optimum at pH6. Knock-out mutant has not obvious phenotype. Predicted to be extracellular.
Orthologs
Proteins
| triacylglycerol lipase 1 | |
|---|---|
| Refseq ID | NP_179126 |
| Protein GI | 30679362 |
| UniProt ID | Q71DJ5 |
| mRNA ID | NM_127084 |
| Length | 393 |
| RefSeq Status | REVIEWED |
| MKWLLVAVLTSLTIFSALTQSHLLHGSPVNSLCADLIHPANYSCTEHSIQTKDGYILALQRVASLGPRLQSGPPVLLQHGLFMAGDVWFLNSPKESLGFILADHGFDVWVGNVRGTRYSYGHVTLSDTDKEFWDWSWQDLAMYDLAEMIQYLYSISNSKIFLVGHSQGTIMSFAALTQPHVAEMVEAAALLCPISYLDHVTAPLVERMVFMHLDQMVVALGLHQINFRSDMLVKLVDSLCEGHMDCTDFLTSITGTNCCFNASKIEYYLDYEPHPSSVKNIRHLFQMIRKGTFAQYDYGYFKNLRTYGLSKPPEFILSHIPASLPMWMGYGGTDGLADVTDVEHTLAELPSSPELLYLEDYGHIDFVLGSSAKEDVYKHMIQFFRAKVKSSSW | |
Gene Information
Entrez Gene ID
Gene Name
triacylglycerol lipase 1
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016788 | IEA:InterPro | F | hydrolase activity, acting on ester bonds |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP011405 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 30679362 | RefSeq | NP_179126 | 393 | triacylglycerol lipase 1 |
Identical Sequences to LMP011405 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30679362 | DBBJ | BAF01428.1 | 393 | putative lysosomal acid lipase [Arabidopsis thaliana] |
| GI:30679362 | EMBL | CAF32514.1 | 393 | unnamed protein product [Arabidopsis thaliana] |
| GI:30679362 | GenBank | AAN77143.1 | 393 | putative triacylglycerol/steryl ester hydrolase [Arabidopsis thaliana] |
| GI:30679362 | GenBank | ABF58965.1 | 393 | At2g15230 [Arabidopsis thaliana] |
| GI:30679362 | GenBank | AEC06377.1 | 393 | triacylglycerol lipase 1 [Arabidopsis thaliana] |
| GI:30679362 | SwissProt | Q71DJ5.1 | 393 | RecName: Full=Triacylglycerol lipase 1; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP011405 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30679362 | EMBL | CAF32515.1 | 372 | unnamed protein product, partial [Arabidopsis thaliana] |
| GI:30679362 | EMBL | CAX69273.1 | 395 | unnamed protein product [Brassica napus] |
| GI:30679362 | GenBank | EFH60143.1 | 393 | ATLIP1 [Arabidopsis lyrata subsp. lyrata] |
| GI:30679362 | RefSeq | XP_002883884.1 | 393 | ATLIP1 [Arabidopsis lyrata subsp. lyrata] |
| GI:30679362 | RefSeq | XP_010518035.1 | 394 | PREDICTED: triacylglycerol lipase 1 [Camelina sativa] |
| GI:30679362 | RefSeq | XP_010488943.1 | 395 | PREDICTED: triacylglycerol lipase 1 [Camelina sativa] |