Gene/Proteome Database (LMPD)

LMPD ID
LMP011405
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
triacylglycerol lipase 1
Gene Symbol
Synonyms
ATLIP1; F15A23.3; F15A23_3; LIP1; lipase 1
Chromosome
2
Summary
Lipase active on medium and short chain triacylglycerols, but not on phospho- or galactolipids. Active between pH4 and 7 with an optimum at pH6. Knock-out mutant has not obvious phenotype. Predicted to be extracellular.
Orthologs

Proteins

triacylglycerol lipase 1
Refseq ID NP_179126
Protein GI 30679362
UniProt ID Q71DJ5
mRNA ID NM_127084
Length 393
RefSeq Status REVIEWED
MKWLLVAVLTSLTIFSALTQSHLLHGSPVNSLCADLIHPANYSCTEHSIQTKDGYILALQRVASLGPRLQSGPPVLLQHGLFMAGDVWFLNSPKESLGFILADHGFDVWVGNVRGTRYSYGHVTLSDTDKEFWDWSWQDLAMYDLAEMIQYLYSISNSKIFLVGHSQGTIMSFAALTQPHVAEMVEAAALLCPISYLDHVTAPLVERMVFMHLDQMVVALGLHQINFRSDMLVKLVDSLCEGHMDCTDFLTSITGTNCCFNASKIEYYLDYEPHPSSVKNIRHLFQMIRKGTFAQYDYGYFKNLRTYGLSKPPEFILSHIPASLPMWMGYGGTDGLADVTDVEHTLAELPSSPELLYLEDYGHIDFVLGSSAKEDVYKHMIQFFRAKVKSSSW

Gene Information

Entrez Gene ID
Gene Name
triacylglycerol lipase 1
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016788 IEA:InterPro F hydrolase activity, acting on ester bonds
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR000073 Alpha/beta hydrolase fold-1
IPR025483 Lipase, eukaryotic
IPR006693 Partial AB-hydrolase lipase domain

UniProt Annotations

Entry Information

Gene Name
triacylglycerol lipase 1
Protein Entry
LIP1_ARATH
UniProt ID
Species
Arabidopsis

Identical and Related Proteins

Unique RefSeq proteins for LMP011405 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
30679362 RefSeq NP_179126 393 triacylglycerol lipase 1

Identical Sequences to LMP011405 proteins

Reference Database Accession Length Protein Name
GI:30679362 DBBJ BAF01428.1 393 putative lysosomal acid lipase [Arabidopsis thaliana]
GI:30679362 EMBL CAF32514.1 393 unnamed protein product [Arabidopsis thaliana]
GI:30679362 GenBank AAN77143.1 393 putative triacylglycerol/steryl ester hydrolase [Arabidopsis thaliana]
GI:30679362 GenBank ABF58965.1 393 At2g15230 [Arabidopsis thaliana]
GI:30679362 GenBank AEC06377.1 393 triacylglycerol lipase 1 [Arabidopsis thaliana]
GI:30679362 SwissProt Q71DJ5.1 393 RecName: Full=Triacylglycerol lipase 1; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011405 proteins

Reference Database Accession Length Protein Name
GI:30679362 EMBL CAF32515.1 372 unnamed protein product, partial [Arabidopsis thaliana]
GI:30679362 EMBL CAX69273.1 395 unnamed protein product [Brassica napus]
GI:30679362 GenBank EFH60143.1 393 ATLIP1 [Arabidopsis lyrata subsp. lyrata]
GI:30679362 RefSeq XP_002883884.1 393 ATLIP1 [Arabidopsis lyrata subsp. lyrata]
GI:30679362 RefSeq XP_010518035.1 394 PREDICTED: triacylglycerol lipase 1 [Camelina sativa]
GI:30679362 RefSeq XP_010488943.1 395 PREDICTED: triacylglycerol lipase 1 [Camelina sativa]