Gene/Proteome Database (LMPD)

LMPD ID
LMP011431
Gene ID
Species
Arabidopsis thaliana (Arabidopsis)
Gene Name
hypothetical protein
Gene Symbol
Synonyms
T6K21.90; T6K21_90
Alternate Names
hypothetical protein
Chromosome
4

Proteins

uncharacterized protein
Refseq ID NP_193525
Protein GI 240255979
UniProt ID B3H6K1
mRNA ID NM_117901
Length 434
RefSeq Status REVIEWED
MTFLLFQLLVLLRYSIGFHCKIDNNGVKSVTSKKNDDEKIVISRNWKAAISLDFIFIVFPMLLFFTVLSEWVYHGTGLLSLLVLILSVTAKRSFSGLQRGQSLSFRASVSSYRVALMLITCLCILAVDFTIFPRRYAKTETYGTSLMDLGVGSFVLANAVVSRQARDVSSGNWITGIKATAPLLLLGFIRLVTTSGVDYQVHVTEYGVHWNFFFTLAAISILTSFVNIPAKYCGLLGFAVLAGYQTWLLSGLNTYLLSDERGTDIISKNKEGVYSILGYWGMYLLGVHLGYRLFYGKHTNIRSTTSSIARVFLVSLLLWIVTILFDNYVERISRRTCNMPYVTWVLAQDLQALGIFMLSSYIPLNKLSSLEEAIDQNLLATFLLANLVTGMVNLTVDTIFASPFSSLLILTAYAFALSAIIGTIHFSGFRLKFW

Gene Information

Entrez Gene ID
Gene Name
hypothetical protein
Gene Symbol
Species
Arabidopsis thaliana

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IEA:InterPro C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016746 IEA:InterPro F transferase activity, transferring acyl groups
GO:0006506 IEA:InterPro P GPI anchor biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ath_M00065 GPI-anchor biosynthesis, core oligosaccharide
ath00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
ath01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
6253955 Synthesis of glycosylphosphatidylinositol (GPI)

Domain Information

InterPro Annotations

Accession Description
IPR009447 GWT1

UniProt Annotations

Entry Information

Gene Name
hypothetical protein
Protein Entry
Y4791_ARATH
UniProt ID
Species
Arabidopsis

Comments

Comment Type Description
Sequence Caution Sequence=BX835579; Type=Miscellaneous discrepancy; Note=Sequencing errors.; Evidence={ECO:0000305}; Sequence=CAA17134.1; Type=Erroneous gene model prediction; Note=The predicted gene has been split into 3 genes: At4g17905, At4g17910 and At4g17915.; Evidence={ECO:0000305}; Sequence=CAB78793.1; Type=Erroneous gene model prediction; Note=The predicted gene has been split into 3 genes: At4g17905, At4g17910 and At4g17915.; Evidence={ECO:0000305};
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP011431 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
240255979 RefSeq NP_193525 434 uncharacterized protein

Identical Sequences to LMP011431 proteins

Reference Database Accession Length Protein Name
GI:240255979 GenBank AEE83967.1 434 uncharacterized protein AT4G17910 [Arabidopsis thaliana]
GI:240255979 SwissProt B3H6K1.2 434 RecName: Full=Uncharacterized protein At4g17910; Flags: Precursor [Arabidopsis thaliana]

Related Sequences to LMP011431 proteins

Reference Database Accession Length Protein Name
GI:240255979 GenBank EOA18094.1 430 hypothetical protein CARUB_v10006550mg, partial [Capsella rubella]
GI:240255979 RefSeq XP_002868031.1 746 hypothetical protein ARALYDRAFT_354960 [Arabidopsis lyrata subsp. lyrata]
GI:240255979 RefSeq XP_006285196.1 430 hypothetical protein CARUB_v10006550mg, partial [Capsella rubella]
GI:240255979 RefSeq XP_010434602.1 468 PREDICTED: uncharacterized protein At4g17910-like [Camelina sativa]
GI:240255979 RefSeq XP_010439924.1 469 PREDICTED: uncharacterized protein At4g17910-like [Camelina sativa]
GI:240255979 RefSeq XP_010449538.1 468 PREDICTED: uncharacterized protein At4g17910 [Camelina sativa]