Gene/Proteome Database (LMPD)
Proteins
| uncharacterized protein | |
|---|---|
| Refseq ID | NP_193525 |
| Protein GI | 240255979 |
| UniProt ID | B3H6K1 |
| mRNA ID | NM_117901 |
| Length | 434 |
| RefSeq Status | REVIEWED |
| MTFLLFQLLVLLRYSIGFHCKIDNNGVKSVTSKKNDDEKIVISRNWKAAISLDFIFIVFPMLLFFTVLSEWVYHGTGLLSLLVLILSVTAKRSFSGLQRGQSLSFRASVSSYRVALMLITCLCILAVDFTIFPRRYAKTETYGTSLMDLGVGSFVLANAVVSRQARDVSSGNWITGIKATAPLLLLGFIRLVTTSGVDYQVHVTEYGVHWNFFFTLAAISILTSFVNIPAKYCGLLGFAVLAGYQTWLLSGLNTYLLSDERGTDIISKNKEGVYSILGYWGMYLLGVHLGYRLFYGKHTNIRSTTSSIARVFLVSLLLWIVTILFDNYVERISRRTCNMPYVTWVLAQDLQALGIFMLSSYIPLNKLSSLEEAIDQNLLATFLLANLVTGMVNLTVDTIFASPFSSLLILTAYAFALSAIIGTIHFSGFRLKFW | |
Gene Information
Entrez Gene ID
Gene Name
hypothetical protein
Gene Symbol
Species
Arabidopsis thaliana
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IEA:InterPro | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016746 | IEA:InterPro | F | transferase activity, transferring acyl groups |
| GO:0006506 | IEA:InterPro | P | GPI anchor biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ath_M00065 | GPI-anchor biosynthesis, core oligosaccharide |
| ath00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
| ath01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6253955 | Synthesis of glycosylphosphatidylinositol (GPI) |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009447 | GWT1 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Sequence Caution | Sequence=BX835579; Type=Miscellaneous discrepancy; Note=Sequencing errors.; Evidence={ECO:0000305}; Sequence=CAA17134.1; Type=Erroneous gene model prediction; Note=The predicted gene has been split into 3 genes: At4g17905, At4g17910 and At4g17915.; Evidence={ECO:0000305}; Sequence=CAB78793.1; Type=Erroneous gene model prediction; Note=The predicted gene has been split into 3 genes: At4g17905, At4g17910 and At4g17915.; Evidence={ECO:0000305}; |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011431 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 240255979 | RefSeq | NP_193525 | 434 | uncharacterized protein |
Identical Sequences to LMP011431 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:240255979 | GenBank | AEE83967.1 | 434 | uncharacterized protein AT4G17910 [Arabidopsis thaliana] |
| GI:240255979 | SwissProt | B3H6K1.2 | 434 | RecName: Full=Uncharacterized protein At4g17910; Flags: Precursor [Arabidopsis thaliana] |
Related Sequences to LMP011431 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:240255979 | GenBank | EOA18094.1 | 430 | hypothetical protein CARUB_v10006550mg, partial [Capsella rubella] |
| GI:240255979 | RefSeq | XP_002868031.1 | 746 | hypothetical protein ARALYDRAFT_354960 [Arabidopsis lyrata subsp. lyrata] |
| GI:240255979 | RefSeq | XP_006285196.1 | 430 | hypothetical protein CARUB_v10006550mg, partial [Capsella rubella] |
| GI:240255979 | RefSeq | XP_010434602.1 | 468 | PREDICTED: uncharacterized protein At4g17910-like [Camelina sativa] |
| GI:240255979 | RefSeq | XP_010439924.1 | 469 | PREDICTED: uncharacterized protein At4g17910-like [Camelina sativa] |
| GI:240255979 | RefSeq | XP_010449538.1 | 468 | PREDICTED: uncharacterized protein At4g17910 [Camelina sativa] |