Gene/Proteome Database (LMPD)
Proteins
| nuclear receptor subfamily 2 group F member 5 | |
|---|---|
| Refseq ID | NP_571261 |
| Protein GI | 20589475 |
| UniProt ID | Q06726 |
| mRNA ID | NM_131186 |
| Length | 403 |
| RefSeq Status | PROVISIONAL |
| MAMVVNQWQENISADPGSQLQMCSQEPGGTPGTPSGSTPGNDALSGDKIPNVDCMVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRGNRDCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMSNSQSSPGQYLSNGSDPYNGQPYLSGFISLLLRAEPYPTSRYGAQCMQSNNLMGIENICELAARLLFSAVEWAKNIPFFPDLQLMDQVALLRMSWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSAERVVAFMDHIRVFQEQVEKLKALQVDTAEYSCLKSIVLFTSDAMGLSDVAHVESIQEKSQCALEEYVRNQYPNQPNRFGRLLLRLPSLRIVSSPVIEQLFFVRLVGKTPIETLLRDMLLSGSSYNWPYMPVQRDRPISIHYNENGP | |
Gene Information
Entrez Gene ID
Gene Name
nuclear receptor subfamily 2, group F, member 5
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0004879 | IEA:InterPro | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Gene Name
nuclear receptor subfamily 2, group F, member 5
Protein Entry
NR2F5_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the nuclear hormone receptor family. |
| Similarity | Contains nuclear receptor DNA-binding domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011475 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 20589475 | RefSeq | NP_571261 | 403 | nuclear receptor subfamily 2 group F member 5 |
Identical Sequences to LMP011475 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20589475 | EMBL | CAA49781.1 | 403 | spv 46 [Danio rerio] |
| GI:20589475 | GenBank | AAI62999.1 | 403 | Nr2f5 protein [Danio rerio] |
| GI:20589475 | GenBank | AAI62963.1 | 403 | Nuclear receptor subfamily 2, group F, member 5 [Danio rerio] |
| GI:20589475 | SwissProt | Q06726.1 | 403 | RecName: Full=Nuclear receptor subfamily 2 group F member 5; AltName: Full=Steroid receptor homolog SVP 46 [Danio rerio] |
Related Sequences to LMP011475 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20589475 | RefSeq | XP_003443189.1 | 404 | PREDICTED: nuclear receptor subfamily 2 group F member 5-like isoform X1 [Oreochromis niloticus] |
| GI:20589475 | RefSeq | XP_004568636.1 | 404 | PREDICTED: nuclear receptor subfamily 2 group F member 5-like [Maylandia zebra] |
| GI:20589475 | RefSeq | XP_005744124.1 | 404 | PREDICTED: nuclear receptor subfamily 2 group F member 5-like isoform X1 [Pundamilia nyererei] |
| GI:20589475 | RefSeq | XP_005923742.1 | 404 | PREDICTED: nuclear receptor subfamily 2 group F member 5-like isoform X1 [Haplochromis burtoni] |
| GI:20589475 | RefSeq | XP_007242214.1 | 403 | PREDICTED: nuclear receptor subfamily 2 group F member 5-like [Astyanax mexicanus] |
| GI:20589475 | RefSeq | XP_008279310.1 | 404 | PREDICTED: nuclear receptor subfamily 2 group F member 5 [Stegastes partitus] |