Gene/Proteome Database (LMPD)
Proteins
| retinoic acid receptor alpha-A | |
|---|---|
| Refseq ID | NP_571481 |
| Protein GI | 62990125 |
| UniProt ID | Q90271 |
| mRNA ID | NM_131406 |
| Length | 444 |
| RefSeq Status | PROVISIONAL |
| MYESVDVNPFLMMDYYNQSRGCLIPDKMPHPFSSSIRHQHWSGSNHSIETQSTSSEEIVPSPPSPPPPPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHREKNCIINKVTRNRCQYCRLQKCLEVGMSKESVRNDRNKKKKEEKKPECTENYTLSPDTEQMIDRVRKAHQETFPSLCQLGKYTTSNSSERRVALDVDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLLCGDRQDLEQADKVDVLQEPLLEALKIYVRNRRPHKPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLESSSGAQGSRASATTPGSCSPSLSPNSAQSSPPTQSP | |
Gene Information
Entrez Gene ID
Gene Name
retinoic acid receptor, alpha a
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0003708 | IDA:UniProtKB | F | retinoic acid receptor activity |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0021575 | IDA:UniProtKB | P | hindbrain morphogenesis |
| GO:0032526 | IDA:UniProtKB | P | response to retinoic acid |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Gene Name
retinoic acid receptor, alpha a
Protein Entry
Q90271_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Not expressed maternally. First detected at 8 hours post-fertilization (hpf) during gastrulation, with expression being restricted to the posterior epiblast. Expression then increases, reaching a peak at 24 hpf and decreasing from 30- 48 hpf. At 9 hpf, expressed throughout the dorsal epiblast except at the dorsal midline, and ventrally in prospective tail and head regions. At 10-11 hpf, expressed in presumptive hindbrain, posterior neural plate, lateral mesoderm and tail bud. At 12 hpf, strongly expressed in the neural epithelium and tail bud and expressed at low levels elsewhere including the eye. At 24 hpf, restricted to the hindbrain with an anterior border at rhombomere 6-7, to anterior spinal cord and to head mesenchyme just posterior to the otic vesicle. At 48 hpf, hindbrain expression remains and there is diffuse expression in non-neural tissue in the pharyngeal region. {ECO:0000269|PubMed:16455309, ECO:0000269|PubMed:18929555, ECO:0000269|PubMed:7918098}. |
| Domain | Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain. |
| Function | Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The rar/rxr heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5 (By similarity). Required for hindbrain patterning. {ECO:0000250, ECO:0000269|PubMed:18929555}. |
| Induction | By retinoic acid in embryos. |
| Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407}. |
| Subunit | Heterodimer; with an rxr molecule. Binds DNA preferentially as a rar/rxr heterodimer. |
| Tissue Specificity | In the embryo, zygotic expression largely overlaps that of rarab, with high levels in hindbrain, lateral mesoderm and tail bud. In the adult, strong expression in brain and muscle, weaker expression in ovary, liver and digestive tract. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011485 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 62990125 | RefSeq | NP_571481 | 444 | retinoic acid receptor alpha-A |
Identical Sequences to LMP011485 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62990125 | GenBank | AAB32276.1 | 444 | retinoic acid receptor alpha [Danio rerio] |
| GI:62990125 | GenBank | AAH92692.1 | 444 | Retinoic acid receptor, alpha a [Danio rerio] |
| GI:62990125 | SwissProt | Q90271.2 | 444 | RecName: Full=Retinoic acid receptor alpha-A; Short=RAR-alpha-A; AltName: Full=Nuclear receptor subfamily 1 group B member 1-A; AltName: Full=Retinoic acid receptor alpha; Short=zRAR alpha; AltName: Full=Retinoic acid receptor alpha-2.A; Short=RAR-alpha-2.A [Danio rerio] |
Related Sequences to LMP011485 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:62990125 | EMBL | CAB43871.1 | 454 | retinoic acid receptor alpha-2 [Takifugu rubripes] |
| GI:62990125 | EMBL | CAB43979.1 | 454 | retinoic acid receptor alpha-2 [Takifugu rubripes] |
| GI:62990125 | GenBank | AAA50049.1 | 444 | retinoic acid receptor alpha-2.A [Danio rerio] |
| GI:62990125 | RefSeq | NP_001027925.1 | 454 | retinoic acid receptor alpha [Takifugu rubripes] |
| GI:62990125 | RefSeq | XP_007559719.1 | 455 | PREDICTED: retinoic acid receptor alpha isoform X1 [Poecilia formosa] |
| GI:62990125 | RefSeq | XP_008436077.1 | 455 | PREDICTED: retinoic acid receptor alpha isoform X1 [Poecilia reticulata] |