Gene/Proteome Database (LMPD)
Proteins
| apolipoprotein A-IV precursor | |
|---|---|
| Refseq ID | NP_001073330 |
| Protein GI | 119943123 |
| UniProt ID | Q3B7G4 |
| mRNA ID | NM_001079861 |
| Length | 255 |
| RefSeq Status | PROVISIONAL |
| MKLYLILAFVAFTGCQANLFYADEPKPQLEQLTDAFWSYVSKATQTAEETVKMIRESQLGQEVNERLTQSADMASEYAVTLKKQVDPLTEELMNKITKETEVLRERLGQDLINVREKLEPYADNMKSQIQQRVEELRAAMAPYADSLDSETLKATLLQKSEELRGNLEQSVKELQAQLEPYTAELKEKVDQHLQEFQETVSPLAEDLQVQIRERAQIVQQSLTPYAEDLKEKLDPYAQNLKDQLISLYDSFTKRY | |
Gene Information
Entrez Gene ID
Gene Name
apolipoprotein A-IV b, tandem duplicate 1
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-SubCell | C | extracellular region |
| GO:0008289 | IEA:InterPro | F | lipid binding |
| GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
| GO:0042157 | IEA:InterPro | P | lipoprotein metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000074 | Apolipoprotein A/E |
UniProt Annotations
Entry Information
Gene Name
apolipoprotein A-IV b, tandem duplicate 1
Protein Entry
Q3B7G4_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011540 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 119943123 | RefSeq | NP_001073330 | 255 | apolipoprotein A-IV precursor |
Identical Sequences to LMP011540 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:119943123 | GenBank | AAI07621.1 | 255 | Apolipoprotein A-IV [Danio rerio] |
Related Sequences to LMP011540 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:119943123 | GenBank | AAH76032.1 | 260 | Apolipoprotein A-IV, partial [Danio rerio] |
| GI:119943123 | GenBank | AAH93239.1 | 268 | Apolipoprotein A-IV, partial [Danio rerio] |
| GI:119943123 | GenBank | AAI62715.1 | 255 | Zgc:194131 [Danio rerio] |
| GI:119943123 | GenBank | AAI62716.1 | 255 | Zgc:194131 [Danio rerio] |
| GI:119943123 | RefSeq | XP_001338037.1 | 255 | PREDICTED: apolipoprotein A-I-like [Danio rerio] |
| GI:119943123 | RefSeq | NP_001122230.1 | 255 | apolipoprotein A-IV-like precursor [Danio rerio] |