Gene/Proteome Database (LMPD)
Proteins
| elongation of very long chain fatty acids protein 7 | |
|---|---|
| Refseq ID | NP_956072 |
| Protein GI | 41054265 |
| UniProt ID | Q7ZTU5 |
| mRNA ID | NM_199778 |
| Length | 282 |
| RefSeq Status | PROVISIONAL |
| MAFNTLTSRAVLLYDEWLKEADPRTGNWLLMGSPFPQTFIIAAYVFFVTTLGPRLMENRKPFQLKNTMIIYNLSIVLFSLYMIYEFLMSGWANGYTYRCDLVDYSSSPQALRMAWTCWLYYFSKFIEMLDTVFFVLRKKSSQVSFLHVYHHSIMPFTWWFGVRFAPGGLGTFHALLNCIVHVIMYSYYLLSALGPKYQKYLWWKKYMTTIQLVQFVLVTAHIGQFFFMQDCPYQFPVFLYIIGLYGLIFLLLFLHFYYHAYTRGKRLPKVLQNRNLLLKKLD | |
Gene Information
Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 7b
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Gene Name
ELOVL fatty acid elongase 7b
Protein Entry
Q7ZTU5_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Similarity | Belongs to the ELO family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011573 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41054265 | RefSeq | NP_956072 | 282 | elongation of very long chain fatty acids protein 7 |
Identical Sequences to LMP011573 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41054265 | GenBank | AAH51608.1 | 282 | ELOVL family member 7, elongation of long chain fatty acids (yeast) b [Danio rerio] |
Related Sequences to LMP011573 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41054265 | EMBL | CDQ79816.1 | 370 | unnamed protein product [Oncorhynchus mykiss] |
| GI:41054265 | RefSeq | XP_006626970.1 | 280 | PREDICTED: elongation of very long chain fatty acids protein 7-like [Lepisosteus oculatus] |
| GI:41054265 | RefSeq | XP_007250351.1 | 286 | PREDICTED: elongation of very long chain fatty acids protein 7 isoform X1 [Astyanax mexicanus] |
| GI:41054265 | RefSeq | XP_007250352.1 | 286 | PREDICTED: elongation of very long chain fatty acids protein 7 isoform X2 [Astyanax mexicanus] |
| GI:41054265 | RefSeq | XP_007250353.1 | 286 | PREDICTED: elongation of very long chain fatty acids protein 7 isoform X3 [Astyanax mexicanus] |
| GI:41054265 | RefSeq | XP_007250354.1 | 286 | PREDICTED: elongation of very long chain fatty acids protein 7 isoform X4 [Astyanax mexicanus] |