Gene/Proteome Database (LMPD)
Proteins
| insulin-induced gene 1 protein | |
|---|---|
| Refseq ID | NP_956163 |
| Protein GI | 41054085 |
| UniProt ID | Q8AV61 |
| mRNA ID | NM_199869 |
| Length | 251 |
| RefSeq Status | PROVISIONAL |
| MPRLEEHCWSCSCSTSVKTKDLSSAGWIVCKTGEMMSIITSVLSHAYGSLHSLQSANLIRRGLVLFIVGVVLALVLNLLQIQRNVTLFPEEVLDTLFSSAWWIPLCCGTAAAVVGLLYPCLDHHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGFGLGLTTALLATLIAQLLVYNGIYQYTSPDFLYVRSWLPCIFFSGGVTVGNIGRQLAMGSTEKIHND | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008203 | IEA:UniProtKB-KW | P | cholesterol metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Mediates feedback control of cholesterol synthesis. |
| Similarity | Belongs to the INSIG family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011583 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41054085 | RefSeq | NP_956163 | 251 | insulin-induced gene 1 protein |
Identical Sequences to LMP011583 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41054085 | GenBank | AAN28327.1 | 251 | INSIG-1 membrane protein [Danio rerio] |
| GI:41054085 | GenBank | AAH45341.1 | 251 | Insulin induced gene 1 [Danio rerio] |
| GI:41054085 | GenBank | AAI65115.1 | 251 | Insig1 protein [Danio rerio] |
| GI:41054085 | SwissProt | Q8AV61.1 | 251 | RecName: Full=Insulin-induced gene 1 protein; Short=INSIG-1 [Danio rerio] |
Related Sequences to LMP011583 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41054085 | EMBL | CDQ56031.1 | 548 | unnamed protein product [Oncorhynchus mykiss] |
| GI:41054085 | RefSeq | XP_005798641.1 | 275 | PREDICTED: insulin-induced gene 1 protein-like [Xiphophorus maculatus] |
| GI:41054085 | RefSeq | XP_006634580.1 | 322 | PREDICTED: insulin-induced gene 1 protein-like [Lepisosteus oculatus] |
| GI:41054085 | RefSeq | XP_007555682.1 | 275 | PREDICTED: insulin-induced gene 1 protein [Poecilia formosa] |
| GI:41054085 | RefSeq | XP_008279016.1 | 252 | PREDICTED: insulin-induced gene 1 protein [Stegastes partitus] |
| GI:41054085 | RefSeq | XP_008394972.1 | 275 | PREDICTED: insulin-induced gene 1 protein [Poecilia reticulata] |