Gene/Proteome Database (LMPD)
LMPD ID
LMP011600
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5a
Gene Symbol
Synonyms
Lc3; b3gnt5; fb12f12; wu:fb12f12; wu:fe50g08
Alternate Names
lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A; BGnT-5A; beta3Gn-T5A; lc3 synthase A; beta-1,3-Gn-T5A; lc(3)Cer synthase A; lactotriaosylceramide synthase A; beta-1,3-N-acetylglucosaminyltransferase 5A; beta-1,3-N-acetylglucosaminyltransferase-5A; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5; UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5A
Chromosome
11
EC Number
2.4.1.206
Proteins
| lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A precursor | |
|---|---|
| Refseq ID | NP_942577 |
| Protein GI | 38564431 |
| UniProt ID | Q7T3S5 |
| mRNA ID | NM_198876 |
| Length | 379 |
| RefSeq Status | PROVISIONAL |
| MFMNCRRVKKWHFLQLLSMCCVMSVLMVCWEHVDHHVVSHVKSYSYRYLINSYDFINKSLSVSPEEAARFGSFPYLLDRRDVCKNKDVLLLLFVKSSPGNFKRRQAIRSTWGNESYISQELGVVVKVVFAMGVRPDRSGHKTMQRELRKEHMAHHDLIQQDFLDTFHNLTVKLLLQFRWTHENCAHAHFLMSADDDVFIHVPNLVHYLQELKSQNVRNLWVGHVHRGAPPVRKRDSKYYMPFDMYQWSSYPDYTAGAGYVVSGDVAAKIYQATQSLNASMYIDDVFMGICAIAAGVSPQEHVYFSGEGKTPYHPCIYEKMITSHGHEGDIRYLWKAATGPQVEGISSGLLGKLYCAAVKMTLLCKPYFTNTYSCMAAFT | |
Gene Information
Entrez Gene ID
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5a
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008378 | IEA:InterPro | F | galactosyltransferase activity |
| GO:0047256 | IEA:UniProtKB-EC | F | lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase activity |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| dre00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| dre_M00070 | Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer |
| dre_M00071 | Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer |
| dre01100 | Metabolic pathways |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002659 | Glycosyl transferase, family 31 |
UniProt Annotations
Entry Information
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5a
Protein Entry
B3G5A_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + beta-D- galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide = UDP + N- acetyl-beta-D-glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D- glucosyl-(1<->1)-ceramide. |
| Developmental Stage | Expressed in 2 distinct phases during the embryogenesis. The early phase extends from late blastulation to the completion of epiboly, during which the expression occurs in the superficial layer of the embryos. The second phase of expression starts during mid-segmentation and persists until day 3, during which the expression occurs prominently in the developing lens. {ECO:0000269|PubMed:14579371}. |
| Function | Beta-1,3-N-acetylglucosaminyltransferase that plays a key role in the synthesis of lacto- or neolacto-series carbohydrate chains on glycolipids. {ECO:0000250}. |
| Induction | Hedgehog signaling is required for expression in embryonic lens. {ECO:0000269|PubMed:14579371}. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 31 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011600 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 38564431 | RefSeq | NP_942577 | 379 | lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A precursor |
Identical Sequences to LMP011600 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:38564431 | GenBank | AAP42946.1 | 379 | Lc3 synthase [Danio rerio] |
| GI:38564431 | GenBank | AAH75943.1 | 379 | UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 [Danio rerio] |
| GI:38564431 | SwissProt | Q7T3S5.1 | 379 | RecName: Full=Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A; AltName: Full=Lactotriaosylceramide synthase A; Short=Lc(3)Cer synthase A; Short=Lc3 synthase A; AltName: Full=UDP-GlcNAc:beta-Gal beta-1,3-N-acetylglucosaminyltransferase 5A; Short=BGnT-5A; Short=Beta-1,3-Gn-T5A; Short=Beta-1,3-N-acetylglucosaminyltransferase 5A; Short=Beta3Gn-T5A [Danio rerio] |
Related Sequences to LMP011600 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:38564431 | EMBL | CDQ79954.1 | 379 | unnamed protein product [Oncorhynchus mykiss] |
| GI:38564431 | GenBank | ADO28988.1 | 379 | UDP-glcnac:betagal beta-13-n-acetylglucosaminyltransferase 5a [Ictalurus punctatus] |
| GI:38564431 | RefSeq | NP_001188171.1 | 379 | UDP-glcnac:betagal beta-13-n-acetylglucosaminyltransferase 5a [Ictalurus punctatus] |
| GI:38564431 | RefSeq | XP_006637460.1 | 379 | PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A-like [Lepisosteus oculatus] |
| GI:38564431 | RefSeq | XP_007252632.1 | 379 | PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A-like [Astyanax mexicanus] |
| GI:38564431 | RefSeq | XP_008282957.1 | 387 | PREDICTED: lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase A-like [Stegastes partitus] |