Gene/Proteome Database (LMPD)
Proteins
| dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial | |
|---|---|
| Refseq ID | NP_958895 |
| Protein GI | 41393131 |
| UniProt ID | Q7ZVL3 |
| mRNA ID | NM_201487 |
| Length | 458 |
| RefSeq Status | PROVISIONAL |
| MLCHSRCLSRSLGRSITALRQGNSVLARRATSGIAASQCVSFQDSPRCETRSSVYQIRYFKTTAAHRNEVITVKTPAFAESVTEGDVRWEKAVGDSVAEDEVVCEIETDKTSVQVPSPAAGVIEELLVPDGGKVEGGTPLFKLKKGAGAVKTAAAVGAPPPAAKTPAPAAPAPAAAPAGGPIPSSMPPVPAVPAQPIQAKPVSAIKPTAAAPAAAAADTGAKAPRSEHRVKMNRMRLRIAQRLKEAQNTCAMLTTFNEVDMSNITEMRTHYKDAFLKKHGIKLGFMSAFVKAAAYALTDQPAVNAVIDDTTKEIVYRDYVDISVAVATPKGLVVPVIRGVEGMNFADIEKTINELGEKARKNELAVEDMDGGTFTISNGGVFGSMFGTPIINPPQSAILGMHGIFDRPVAIAGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKSVVEDPRVLLLDM | |
Gene Information
Entrez Gene ID
Gene Name
dihydrolipoamide S-succinyltransferase
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0045252 | IEA:InterPro | C | oxoglutarate dehydrogenase complex |
| GO:0004149 | IEA:InterPro | F | dihydrolipoyllysine-residue succinyltransferase activity |
| GO:0006099 | IEA:InterPro | P | tricarboxylic acid cycle |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR003016 | 2-oxo acid dehydrogenase, lipoyl-binding site |
| IPR001078 | 2-oxoacid dehydrogenase acyltransferase, catalytic domain |
| IPR000089 | Biotin/lipoyl attachment |
| IPR023213 | Chloramphenicol acetyltransferase-like domain |
| IPR006255 | Dihydrolipoamide succinyltransferase |
| IPR011053 | Single hybrid motif |
UniProt Annotations
Entry Information
Gene Name
dihydrolipoamide S-succinyltransferase
Protein Entry
Q7ZVL3_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the 2-oxoacid dehydrogenase family. |
| Similarity | Contains 1 lipoyl-binding domain. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011621 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41393131 | RefSeq | NP_958895 | 458 | dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial |
Identical Sequences to LMP011621 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41393131 | GenBank | AAH45500.1 | 458 | Dihydrolipoamide S-succinyltransferase [Danio rerio] |
Related Sequences to LMP011621 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41393131 | GenBank | AAH65943.1 | 457 | Dlst protein [Danio rerio] |
| GI:41393131 | GenBank | AHH42117.1 | 456 | Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial [Ictalurus punctatus] |
| GI:41393131 | RefSeq | XP_006632416.1 | 459 | PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like [Lepisosteus oculatus] |
| GI:41393131 | RefSeq | XP_007257391.1 | 454 | PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like [Astyanax mexicanus] |
| GI:41393131 | RefSeq | XP_007549333.1 | 458 | PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial [Poecilia formosa] |
| GI:41393131 | RefSeq | XP_008280957.1 | 462 | PREDICTED: dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like [Stegastes partitus] |