Gene/Proteome Database (LMPD)
Proteins
| pleckstrin homology-like domain family A member 3 | |
|---|---|
| Refseq ID | NP_001002455 |
| Protein GI | 50539978 |
| UniProt ID | Q8AW35 |
| mRNA ID | NM_001002455 |
| Length | 127 |
| RefSeq Status | PROVISIONAL |
| MNQCKVMNDGYLEKRSNGLLQLWKKKRCVLSDEGLRLYGCKGDSGKEMRFEQMTTLDCVEYKRGLVYFTIVMNDGKEVDFRCQQEGTAWNAEIALALVRFKNRVAVQTGRNRHLSHLGSCGEGDVEL | |
Gene Information
Entrez Gene ID
Gene Name
pleckstrin homology-like domain, family A, member 3
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0005886 | ISS:UniProtKB | C | plasma membrane |
| GO:0005547 | ISS:UniProtKB | F | phosphatidylinositol-3,4,5-trisphosphate binding |
| GO:0043325 | ISS:UniProtKB | F | phosphatidylinositol-3,4-bisphosphate binding |
| GO:0080025 | ISS:UniProtKB | F | phosphatidylinositol-3,5-bisphosphate binding |
| GO:0032266 | ISS:UniProtKB | F | phosphatidylinositol-3-phosphate binding |
| GO:0005546 | ISS:UniProtKB | F | phosphatidylinositol-4,5-bisphosphate binding |
| GO:0010314 | ISS:UniProtKB | F | phosphatidylinositol-5-phosphate binding |
| GO:0042771 | ISS:UniProtKB | P | intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator |
| GO:0051898 | ISS:UniProtKB | P | negative regulation of protein kinase B signaling |
| GO:0043065 | ISS:UniProtKB | P | positive regulation of apoptotic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
pleckstrin homology-like domain, family A, member 3
Protein Entry
PHLA3_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Domain | The PH domain binds phosphoinositides with a broad specificity. It competes with the PH domain of akt1 and directly interferes with akt1 binding to phosphatidylinositol 4,5- bisphosphate (PIP2) and phosphatidylinositol 3,4,5-trisphosphate (PIP3), preventing akt1 association to membrane lipids and subsequent activation of akt1 signaling (By similarity). {ECO:0000250}. |
| Function | p53/tp53-regulated repressor of Akt/akt1 signaling. Represses akt1 by preventing akt1-binding to membrane lipids, thereby inhibiting akt1 translocation to the cellular membrane and activation. Contributes to p53/tp53-dependent apoptosis by repressing akt1 activity. Its direct transcription regulation by p53/tp53 may explain how p53/tp53 can negatively regulate akt1. May act as a tumor suppressor (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the PHLDA3 family. {ECO:0000305}. |
| Similarity | Contains 1 PH domain. {ECO:0000305}. |
| Subcellular Location | Cytoplasm {ECO:0000250}. Membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP011627 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 50539978 | RefSeq | NP_001002455 | 127 | pleckstrin homology-like domain family A member 3 |
Identical Sequences to LMP011627 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50539978 | EMBL | CAD59121.1 | 127 | SI:dZ182N13.5 (novel protein similar to human pleckstrin homology-like domain, family A, member 3 (PHLDA3)) [Danio rerio] |
| GI:50539978 | GenBank | AAH76016.1 | 127 | Pleckstrin homology-like domain, family A, member 3 [Danio rerio] |
| GI:50539978 | SwissProt | Q8AW35.1 | 127 | RecName: Full=Pleckstrin homology-like domain family A member 3; AltName: Full=TDAG51/Ipl homolog 1 [Danio rerio] |
Related Sequences to LMP011627 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50539978 | RefSeq | XP_004558892.1 | 140 | PREDICTED: pleckstrin homology-like domain family A member 3-like [Maylandia zebra] |
| GI:50539978 | RefSeq | XP_005478074.1 | 140 | PREDICTED: pleckstrin homology-like domain family A member 3-like [Oreochromis niloticus] |
| GI:50539978 | RefSeq | XP_005732572.1 | 140 | PREDICTED: pleckstrin homology-like domain family A member 3-like [Pundamilia nyererei] |
| GI:50539978 | RefSeq | XP_005914751.1 | 140 | PREDICTED: pleckstrin homology-like domain family A member 3-like [Haplochromis burtoni] |
| GI:50539978 | RefSeq | XP_006628390.1 | 146 | PREDICTED: pleckstrin homology-like domain family A member 3-like [Lepisosteus oculatus] |
| GI:50539978 | RefSeq | XP_006785753.1 | 140 | PREDICTED: pleckstrin homology-like domain family A member 3-like [Neolamprologus brichardi] |