Gene/Proteome Database (LMPD)
Proteins
monoglyceride lipase | |
---|---|
Refseq ID | NP_956591 |
Protein GI | 41053549 |
UniProt ID | Q7ZWC2 |
mRNA ID | NM_200297 |
Length | 300 |
RefSeq Status | PROVISIONAL |
MPEPEGTRRSPQGVPYSDLPHIVNADGLHLFCRYWEPDGPPKALVYVAHGAGEHCGGYADIAHSLTQHGILVFAHDHVGHGQSEGERMELKNFQIYVRDSLQHIDIMKARYPKLAVFIVGHSMGGAISILTACERPQDFTGVVLIGPMVQMSAESATPFKVFMAKVLNRLAPKLTLGPIDPKFVSRDPKQVEAYEKDELNYHGGLRVSFGMQMLDATSRIERELPDIRWPFYILHGDADKLCDIRGSRLLYNEAKSTDKKLKVYEEAYHALHHDLPETIESVLKEVSTWILERVPAPQTS |
Gene Information
Gene Ontology (GO Annotations)
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00098 | Acylglycerol degradation |
dre_M00098 | Acylglycerol degradation |
dre00561 | Glycerolipid metabolism |
ko00561 | Glycerolipid metabolism |
dre01100 | Metabolic pathways |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
6176789 | Acyl chain remodeling of DAG and TAG |
6176587 | Arachidonate production from DAG |
6176005 | Effects of PIP2 hydrolysis |
6176002 | G alpha (q) signalling events |
6175993 | GPCR downstream signaling |
6175890 | Gastrin-CREB signalling pathway via PKC and MAPK |
6175824 | Glycerophospholipid biosynthesis |
6175996 | Hemostasis |
6176098 | Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis |
6176099 | Lipid digestion, mobilization, and transport |
6175604 | Metabolism |
6175643 | Metabolism of lipids and lipoproteins |
6175825 | Phospholipid metabolism |
6175995 | Platelet activation, signaling and aggregation |
6175733 | Signal Transduction |
6175743 | Signaling by GPCR |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP011636 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
41053549 | RefSeq | NP_956591 | 300 | monoglyceride lipase |
Identical Sequences to LMP011636 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:41053549 | GenBank | AAH49487.1 | 300 | Monoglyceride lipase [Danio rerio] |
GI:41053549 | GenBank | AAQ97815.1 | 300 | monoglyceride lipase [Danio rerio] |
Related Sequences to LMP011636 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:41053549 | GenBank | AHH37328.1 | 300 | Monoglyceride lipase [Ictalurus punctatus] |
GI:41053549 | RefSeq | XP_003444884.2 | 343 | PREDICTED: monoglyceride lipase-like isoform X1 [Oreochromis niloticus] |
GI:41053549 | RefSeq | XP_005478408.1 | 306 | PREDICTED: monoglyceride lipase-like isoform X3 [Oreochromis niloticus] |
GI:41053549 | RefSeq | XP_005730755.1 | 306 | PREDICTED: monoglyceride lipase-like isoform X1 [Pundamilia nyererei] |
GI:41053549 | RefSeq | XP_008282942.1 | 344 | PREDICTED: monoglyceride lipase isoform X1 [Stegastes partitus] |
GI:41053549 | RefSeq | XP_008282943.1 | 306 | PREDICTED: monoglyceride lipase isoform X2 [Stegastes partitus] |