Gene/Proteome Database (LMPD)
Proteins
| monoglyceride lipase | |
|---|---|
| Refseq ID | NP_956591 |
| Protein GI | 41053549 |
| UniProt ID | Q7ZWC2 |
| mRNA ID | NM_200297 |
| Length | 300 |
| RefSeq Status | PROVISIONAL |
| MPEPEGTRRSPQGVPYSDLPHIVNADGLHLFCRYWEPDGPPKALVYVAHGAGEHCGGYADIAHSLTQHGILVFAHDHVGHGQSEGERMELKNFQIYVRDSLQHIDIMKARYPKLAVFIVGHSMGGAISILTACERPQDFTGVVLIGPMVQMSAESATPFKVFMAKVLNRLAPKLTLGPIDPKFVSRDPKQVEAYEKDELNYHGGLRVSFGMQMLDATSRIERELPDIRWPFYILHGDADKLCDIRGSRLLYNEAKSTDKKLKVYEEAYHALHHDLPETIESVLKEVSTWILERVPAPQTS | |
Gene Information
Gene Ontology (GO Annotations)
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00098 | Acylglycerol degradation |
| dre_M00098 | Acylglycerol degradation |
| dre00561 | Glycerolipid metabolism |
| ko00561 | Glycerolipid metabolism |
| dre01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 6176789 | Acyl chain remodeling of DAG and TAG |
| 6176587 | Arachidonate production from DAG |
| 6176005 | Effects of PIP2 hydrolysis |
| 6176002 | G alpha (q) signalling events |
| 6175993 | GPCR downstream signaling |
| 6175890 | Gastrin-CREB signalling pathway via PKC and MAPK |
| 6175824 | Glycerophospholipid biosynthesis |
| 6175996 | Hemostasis |
| 6176098 | Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis |
| 6176099 | Lipid digestion, mobilization, and transport |
| 6175604 | Metabolism |
| 6175643 | Metabolism of lipids and lipoproteins |
| 6175825 | Phospholipid metabolism |
| 6175995 | Platelet activation, signaling and aggregation |
| 6175733 | Signal Transduction |
| 6175743 | Signaling by GPCR |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP011636 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41053549 | RefSeq | NP_956591 | 300 | monoglyceride lipase |
Identical Sequences to LMP011636 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41053549 | GenBank | AAH49487.1 | 300 | Monoglyceride lipase [Danio rerio] |
| GI:41053549 | GenBank | AAQ97815.1 | 300 | monoglyceride lipase [Danio rerio] |
Related Sequences to LMP011636 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41053549 | GenBank | AHH37328.1 | 300 | Monoglyceride lipase [Ictalurus punctatus] |
| GI:41053549 | RefSeq | XP_003444884.2 | 343 | PREDICTED: monoglyceride lipase-like isoform X1 [Oreochromis niloticus] |
| GI:41053549 | RefSeq | XP_005478408.1 | 306 | PREDICTED: monoglyceride lipase-like isoform X3 [Oreochromis niloticus] |
| GI:41053549 | RefSeq | XP_005730755.1 | 306 | PREDICTED: monoglyceride lipase-like isoform X1 [Pundamilia nyererei] |
| GI:41053549 | RefSeq | XP_008282942.1 | 344 | PREDICTED: monoglyceride lipase isoform X1 [Stegastes partitus] |
| GI:41053549 | RefSeq | XP_008282943.1 | 306 | PREDICTED: monoglyceride lipase isoform X2 [Stegastes partitus] |