Gene/Proteome Database (LMPD)
Proteins
| CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase | |
|---|---|
| Refseq ID | NP_956649 |
| Protein GI | 41054876 |
| UniProt ID | Q7T3B9 |
| mRNA ID | NM_200355 |
| Length | 358 |
| RefSeq Status | PROVISIONAL |
| MVLVFFYYSSGRLQLKNSVQKSQADLDSLLSVGRVVASVYDKQGFLLKLDKKLPLELQYKYGNLSKGECKQGFAQAKMTLIYPKFSKPAPMFLDPNYKRLSKISSYPPPFGVRTQERIIDNILAATRSYFLGPELDSIPCKKCIIIGNGGILFNKSLGTKIDQYDVVVRLNEAPVAGFEKDVGSKTTMRITYPEGAIQRAERYEKSSLFVLSAFKSNDFKWLRHMVYKDRLWRMDGFWKSVARVVPRAPQDMRILNPYFIQEASFRLIGLPHNNGLMGRGNIPTLGTVAITMALHNCDEVAVAGFGYDMNTPHAPLHYYEKLRMSAIKESWTHNISREKEFLRKLVKAGVIEDLTHGI | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3a
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 3a
Protein Entry
Q7T3B9_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011654 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41054876 | RefSeq | NP_956649 | 358 | CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase |
Identical Sequences to LMP011654 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41054876 | GenBank | AAH53179.1 | 358 | ST3 beta-galactoside alpha-2,3-sialyltransferase 3 [Danio rerio] |
Related Sequences to LMP011654 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41054876 | EMBL | CAF25178.1 | 372 | ST3Gal III-related alpha-2,3-sialyltransferase [Danio rerio] |
| GI:41054876 | EMBL | CAG29185.1 | 372 | alpha-2,3-sialyltransferase [Danio rerio] |
| GI:41054876 | RefSeq | XP_007244219.1 | 373 | PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2 [Astyanax mexicanus] |
| GI:41054876 | RefSeq | XP_009300369.1 | 375 | PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X1 [Danio rerio] |
| GI:41054876 | RefSeq | XP_009300370.1 | 359 | PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2 [Danio rerio] |
| GI:41054876 | RefSeq | XP_009300371.1 | 359 | PREDICTED: CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2 [Danio rerio] |