Gene/Proteome Database (LMPD)
Proteins
| beta-1,4-galactosyltransferase 6 | |
|---|---|
| Refseq ID | NP_957232 |
| Protein GI | 41055588 |
| UniProt ID | Q802Y5 |
| mRNA ID | NM_200938 |
| Length | 381 |
| RefSeq Status | PROVISIONAL |
| MWKWRRLMRLSNRSLMAFIFFFSMSTTCLYFIYVAPGIVNTYFFMVQAQGIMLRDNVRTIGHMIRLYTNKNSTLNGTDYPDGSNSSEYIAQPTTYLPENFTYAQNLPCPERLPSMKGQMEVNMTEVPMEEIELRLKHMDIQFGGHWKPKDCKPRWKVAILIPFRNRHERLPILFQHLTPMLQRQRLQFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDLDWDCVVFHDVDHIPENDRNYYGCGQMPRHFAAKLDKYMYILPYNEFFGGVSGLTVEQFLKINGFPNAFWGWGGEDDDLWNRVHYAGFNVTRPEGDIGKYKSIPHHHRGEVQFLGRYKLLRYSKERQHLDGLNNLQYSPEISLSNLYKNITVNLNPELALIAEY | |
Gene Information
Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008489 | IMP:ZFIN | F | UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity |
| GO:0005975 | IEA:InterPro | P | carbohydrate metabolic process |
| GO:0006687 | IMP:ZFIN | P | glycosphingolipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6
Protein Entry
Q802Y5_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011693 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41055588 | RefSeq | NP_957232 | 381 | beta-1,4-galactosyltransferase 6 |
Identical Sequences to LMP011693 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41055588 | GenBank | AAH46890.1 | 381 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 6 [Danio rerio] |
| GI:41055588 | GenBank | AAI64700.1 | 381 | B4galt6 protein [Danio rerio] |
Related Sequences to LMP011693 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41055588 | EMBL | CAG01153.1 | 382 | unnamed protein product [Tetraodon nigroviridis] |
| GI:41055588 | GenBank | AHH41857.1 | 381 | Beta-1,4-galactosyltransferase 6 [Ictalurus punctatus] |
| GI:41055588 | RefSeq | XP_003978651.1 | 382 | PREDICTED: beta-1,4-galactosyltransferase 6-like [Takifugu rubripes] |
| GI:41055588 | RefSeq | XP_006634120.1 | 382 | PREDICTED: beta-1,4-galactosyltransferase 6-like [Lepisosteus oculatus] |
| GI:41055588 | RefSeq | XP_007257075.1 | 381 | PREDICTED: beta-1,4-galactosyltransferase 6 [Astyanax mexicanus] |
| GI:41055588 | RefSeq | XP_008280085.1 | 382 | PREDICTED: beta-1,4-galactosyltransferase 6 [Stegastes partitus] |