Gene/Proteome Database (LMPD)
Proteins
| phosphatidylinositol-glycan biosynthesis class F protein | |
|---|---|
| Refseq ID | NP_991208 |
| Protein GI | 45387713 |
| UniProt ID | Q6P0J9 |
| mRNA ID | NM_205645 |
| Length | 219 |
| RefSeq Status | PROVISIONAL |
| MWDVEIRGMASAHAIIASSIFMATVMPAALVNKFSVYGTHMVWLYCVAGSITVVNIAVFWLLGISPPTKKNTLSYKISRFFRSCLYFLLSCLFFHTVVVLYGAPLLESALETFSLAVLLSTLTTLRCLCILGPNVQAWIRVFSRDGAMSVWDTSLQITTGCSVIGAWLGAFPIPLDWDRPWQVWPISCTLGATIGFLTGLLAAPVWIHWHRKQLTYKLK | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IEA:InterPro | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0006506 | IEA:InterPro | P | GPI anchor biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR009580 | GPI biosynthesis protein Pig-F |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Protein Entry
Q6P0J9_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011722 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 45387713 | RefSeq | NP_991208 | 219 | phosphatidylinositol-glycan biosynthesis class F protein |
Identical Sequences to LMP011722 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45387713 | GenBank | AAH65590.1 | 219 | Phosphatidylinositol glycan, class F [Danio rerio] |
Related Sequences to LMP011722 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:45387713 | EMBL | CDQ84768.1 | 219 | unnamed protein product [Oncorhynchus mykiss] |
| GI:45387713 | GenBank | ACO08944.1 | 219 | Phosphatidylinositol-glycan biosynthesis class F protein [Osmerus mordax] |
| GI:45387713 | GenBank | ADO28537.1 | 219 | phosphatidylinositol-glycan biosynthesis class f protein [Ictalurus punctatus] |
| GI:45387713 | RefSeq | NP_001187356.1 | 219 | phosphatidylinositol-glycan biosynthesis class F protein [Ictalurus punctatus] |
| GI:45387713 | RefSeq | XP_006638698.1 | 219 | PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein-like [Lepisosteus oculatus] |
| GI:45387713 | RefSeq | XP_007231034.1 | 219 | PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein [Astyanax mexicanus] |