Gene/Proteome Database (LMPD)
Proteins
| CDP-diacylglycerol--inositol 3-phosphatidyltransferase | |
|---|---|
| Refseq ID | NP_996971 |
| Protein GI | 46309543 |
| UniProt ID | Q6NYP5 |
| mRNA ID | NM_207088 |
| Length | 213 |
| RefSeq Status | PROVISIONAL |
| MTEENIFLFVPNLIGYARIVLALVSFFLMPCCPGPAVFCYLLSALLDAFDGHAARALNQGTKFGAMLDMLTDRCATMCLLVNLALLYPSYTFLFQLSMCLDVASHWLHLHSSMMKGATSHKAIDLSGNPILRLYYTSRPVLFFMCMGNELFFCLLYIMFYIEEPQVWLQWLLGVCGVVCLLKSGISFLHLITASRNMAAIDVADREKERSKAQ | |
Gene Information
Entrez Gene ID
Gene Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase)
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:InterPro | C | membrane |
| GO:0016780 | IEA:InterPro | F | phosphotransferase activity, for other substituted phosphate groups |
| GO:0007420 | IMP:ZFIN | P | brain development |
| GO:0060219 | IMP:ZFIN | P | camera-type eye photoreceptor cell differentiation |
| GO:0044255 | IMP:ZFIN | P | cellular lipid metabolic process |
| GO:0071788 | IMP:ZFIN | P | endoplasmic reticulum tubular network maintenance |
| GO:0060729 | IMP:ZFIN | P | intestinal epithelial structure maintenance |
| GO:0002088 | IMP:ZFIN | P | lens development in camera-type eye |
| GO:0072576 | IMP:ZFIN | P | liver morphogenesis |
| GO:0006661 | IMP:ZFIN | P | phosphatidylinositol biosynthetic process |
| GO:0034976 | IMP:ZFIN | P | response to endoplasmic reticulum stress |
| GO:0010842 | IMP:ZFIN | P | retina layer formation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase)
Protein Entry
Q6NYP5_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011734 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 46309543 | RefSeq | NP_996971 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase |
Identical Sequences to LMP011734 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:46309543 | GenBank | AAH66511.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase (phosphatidylinositol synthase) [Danio rerio] |
Related Sequences to LMP011734 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:46309543 | GenBank | AAT68039.1 | 213 | phosphatidylinositol synthase [Danio rerio] |
| GI:46309543 | GenBank | AAI55272.1 | 213 | Cdipt protein [Danio rerio] |
| GI:46309543 | GenBank | AHH39814.1 | 213 | CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Ictalurus punctatus] |
| GI:46309543 | RefSeq | XP_007234752.1 | 213 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase [Astyanax mexicanus] |
| GI:46309543 | RefSeq | XP_008289170.1 | 212 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase-like [Stegastes partitus] |
| GI:46309543 | RefSeq | XP_008303587.1 | 212 | PREDICTED: CDP-diacylglycerol--inositol 3-phosphatidyltransferase-like [Stegastes partitus] |