Gene/Proteome Database (LMPD)
Proteins
| estrogen-related receptor gamma | |
|---|---|
| Refseq ID | NP_998119 |
| Protein GI | 47086127 |
| UniProt ID | Q6Q6F4 |
| mRNA ID | NM_212954 |
| Length | 435 |
| RefSeq Status | PROVISIONAL |
| MSNKDRHIESSCPSYIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPTLYGPTGALGPSGTGAKRYEDCSSTITEDSQIKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLTVGMMREGVRLDRVRGGRQKYKRRIDAENSPYLNPQLALPPKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVNIGWAKHIPGFSTLSLADQMSLLQSAWMEILILRVVYRSLSFEDKLVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHVEDPRRAGKLLMTLPLLRQTSTKAVQHFYSIKQDGKVPMHKLFLELLEAKV | |
Gene Information
Entrez Gene ID
Gene Name
estrogen-related receptor gamma a
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-SubCell | C | nucleus |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003700 | IEA:InterPro | F | sequence-specific DNA binding transcription factor activity |
| GO:0005496 | IEA:InterPro | F | steroid binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008946 | Nuclear hormone receptor, ligand-binding |
| IPR000536 | Nuclear hormone receptor, ligand-binding, core |
| IPR024178 | Oestrogen receptor/oestrogen-related receptor |
| IPR027289 | Oestrogen-related receptor |
| IPR001723 | Steroid hormone receptor |
| IPR013088 | Zinc finger, NHR/GATA-type |
| IPR001628 | Zinc finger, nuclear hormone receptor-type |
UniProt Annotations
Entry Information
Gene Name
estrogen-related receptor gamma a
Protein Entry
Q6Q6F4_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the nuclear hormone receptor family. |
| Similarity | Belongs to the nuclear hormone receptor family. NR3 subfamily. |
| Similarity | Contains nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus . |
Identical and Related Proteins
Unique RefSeq proteins for LMP011740 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47086127 | RefSeq | NP_998119 | 435 | estrogen-related receptor gamma |
Identical Sequences to LMP011740 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086127 | GenBank | AAS66636.1 | 435 | estrogen-related receptor gamma [Danio rerio] |
Related Sequences to LMP011740 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086127 | RefSeq | XP_005158828.1 | 508 | PREDICTED: estrogen-related receptor gamma isoform X1 [Danio rerio] |
| GI:47086127 | RefSeq | XP_005158829.1 | 489 | PREDICTED: estrogen-related receptor gamma isoform X3 [Danio rerio] |
| GI:47086127 | RefSeq | XP_006625773.1 | 435 | PREDICTED: estrogen-related receptor gamma-like isoform X4 [Lepisosteus oculatus] |
| GI:47086127 | RefSeq | XP_009291401.1 | 501 | PREDICTED: estrogen-related receptor gamma isoform X2 [Danio rerio] |
| GI:47086127 | RefSeq | XP_009291402.1 | 489 | PREDICTED: estrogen-related receptor gamma isoform X3 [Danio rerio] |
| GI:47086127 | RefSeq | XP_009291403.1 | 442 | PREDICTED: estrogen-related receptor gamma isoform X4 [Danio rerio] |