Gene/Proteome Database (LMPD)
Proteins
| steroid hormone receptor ERR1 | |
|---|---|
| Refseq ID | NP_998120 |
| Protein GI | 47086129 |
| UniProt ID | Q6Q6F6 |
| mRNA ID | NM_212955 |
| Length | 436 |
| RefSeq Status | PROVISIONAL |
| MSSRERRSDLYIKAEPSSPEGGGGGGGGRTSPGGASSDSSQSGGGGSRGEGAGRYSPPLYTPALRCHFKEEGADGAEEGSTGSGGGRCKYALSTLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGNIEYSCPASNECEITKRRRKACQACRFTKCLKVGMLKEGVRLDRVRGGRQKYKRRPEVENATYQSAPIPLRKEGEKGSSSIIVSHLLVAEPEKLFAMPDPLQPDTAQRTLTTLCDLADRELVVIIGWAKHIPGFLSLSLADQMSVLQSVWLEVLVLGVAYRSLGCEDEVVFAEDFVLDEEMSRVAGLTELNAAISQLARRFRALQLDREEFVMLKAIALTNSDSVYIEDMEAVQKLRDLLHQALLELEVQRRPDDPQRAGRLLLTLPLLRQTAGRALTTFYSIKTRGGVPMHKLFLEMLEAMMDSP | |
Gene Information
Entrez Gene ID
Gene Name
estrogen-related receptor alpha
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IC:ZFIN | C | nucleus |
| GO:0043565 | IEA:InterPro | F | sequence-specific DNA binding |
| GO:0003700 | IDA:ZFIN | F | sequence-specific DNA binding transcription factor activity |
| GO:0005496 | IEA:InterPro | F | steroid binding |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0042074 | IMP:ZFIN | P | cell migration involved in gastrulation |
| GO:0006351 | IDA:ZFIN | P | transcription, DNA-templated |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008946 | Nuclear hormone receptor, ligand-binding |
| IPR000536 | Nuclear hormone receptor, ligand-binding, core |
| IPR024178 | Oestrogen receptor/oestrogen-related receptor |
| IPR027289 | Oestrogen-related receptor |
| IPR001723 | Steroid hormone receptor |
| IPR013088 | Zinc finger, NHR/GATA-type |
| IPR001628 | Zinc finger, nuclear hormone receptor-type |
UniProt Annotations
Entry Information
Gene Name
estrogen-related receptor alpha
Protein Entry
Q6Q6F6_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the nuclear hormone receptor family. |
| Similarity | Belongs to the nuclear hormone receptor family. NR3 subfamily. |
| Similarity | Contains nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus . |
Identical and Related Proteins
Unique RefSeq proteins for LMP011741 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 47086129 | RefSeq | NP_998120 | 436 | steroid hormone receptor ERR1 |
Identical Sequences to LMP011741 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086129 | GenBank | AAS66634.1 | 436 | estrogen-related receptor alpha [Danio rerio] |
| GI:47086129 | RefSeq | XP_009293748.1 | 436 | PREDICTED: steroid hormone receptor ERR1 isoform X1 [Danio rerio] |
Related Sequences to LMP011741 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:47086129 | RefSeq | NP_001098387.1 | 433 | estrogen-related receptor alpha [Oryzias latipes] |
| GI:47086129 | RefSeq | XP_005161401.1 | 441 | PREDICTED: steroid hormone receptor ERR1 isoform X2 [Danio rerio] |
| GI:47086129 | RefSeq | XP_007244584.1 | 434 | PREDICTED: estrogen-related receptor gamma-like isoform X1 [Astyanax mexicanus] |
| GI:47086129 | RefSeq | XP_007244585.1 | 434 | PREDICTED: estrogen-related receptor gamma-like isoform X2 [Astyanax mexicanus] |
| GI:47086129 | RefSeq | XP_008288318.1 | 433 | PREDICTED: steroid hormone receptor ERR1-like [Stegastes partitus] |
| GI:47086129 | RefSeq | XP_008288319.1 | 433 | PREDICTED: steroid hormone receptor ERR1-like [Stegastes partitus] |