Gene/Proteome Database (LMPD)
Proteins
GPI-anchor transamidase precursor | |
---|---|
Refseq ID | NP_001002149 |
Protein GI | 50344954 |
UniProt ID | Q6IQM5 |
mRNA ID | NM_001002149 |
Length | 389 |
RefSeq Status | PROVISIONAL |
MDYSNLFTVYSCLLLFVSIPCAYSNYVETKAGQFFSSGHTNNWAVLVCTSRFWFNYRHVANTLSVYRSVKRLGIPDSHIVLMLADDMACNYRNPKPATVFSHKNMELNVYGDDVEVDYRGYEVTVENFLRVLTGRLPLSTPRSKRLLSDDRSNILIYLTGHGGNGFLKFQDSEEISNMELADAFEQMWQKRRYNELLFIIDTCQGASMYERFYSPNIMALASSQVGEDSLSHQPDLAIGVHLMDKYTFYLLEFLEEVHPASQANMNDLFKVCPQSQCVSTPGHRTDLFQRDPGSVLITDFFGSVRKVEITKDTISLTCPVESPMQRSGSGDLQVETFTYVDQLPVAEIIHQKPKQKDWHPPDGFILGLWTLILLVFFQTYGIKHLKHIF |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0042765 | IEA:InterPro | C | GPI-anchor transamidase complex |
GO:0003923 | IEA:InterPro | F | GPI-anchor transamidase activity |
GO:0004197 | IEA:InterPro | F | cysteine-type endopeptidase activity |
GO:0016255 | IEA:InterPro | P | attachment of GPI anchor to protein |
GO:0050976 | IMP:ZFIN | P | detection of mechanical stimulus involved in sensory perception of touch |
GO:0034394 | IMP:ZFIN | P | protein localization to cell surface |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class K
Protein Entry
Q6IQM5_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011799 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
50344954 | RefSeq | NP_001002149 | 389 | GPI-anchor transamidase precursor |
Identical Sequences to LMP011799 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:50344954 | GenBank | AAH71379.1 | 389 | Phosphatidylinositol glycan, class K [Danio rerio] |
Related Sequences to LMP011799 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:50344954 | GenBank | AHH38873.1 | 392 | GPI-anchor transamidase [Ictalurus punctatus] |
GI:50344954 | RefSeq | XP_004555281.1 | 383 | PREDICTED: GPI-anchor transamidase-like [Maylandia zebra] |
GI:50344954 | RefSeq | XP_005924608.1 | 383 | PREDICTED: GPI-anchor transamidase-like isoform X1 [Haplochromis burtoni] |
GI:50344954 | RefSeq | XP_007250729.1 | 391 | PREDICTED: GPI-anchor transamidase [Astyanax mexicanus] |
GI:50344954 | RefSeq | XP_007567477.1 | 383 | PREDICTED: GPI-anchor transamidase isoform X1 [Poecilia formosa] |
GI:50344954 | RefSeq | XP_008432862.1 | 383 | PREDICTED: GPI-anchor transamidase [Poecilia reticulata] |