Gene/Proteome Database (LMPD)
Proteins
| decaprenyl-diphosphate synthase subunit 2 | |
|---|---|
| Refseq ID | NP_001002351 |
| Protein GI | 50539770 |
| UniProt ID | Q6DHQ9 |
| mRNA ID | NM_001002351 |
| Length | 370 |
| RefSeq Status | PROVISIONAL |
| MAWRSRLSYFGLRHLSIFSNPSPSSWTKVVSDAEKIVGYPTSFMSLRCLLSDELSNVAMHVRKLVGTKHPLLNTARGFVYDSRNNLQMRGLVVLLMSKAAGPSSSDPIHDSMVSGIYPSQRNLAEITELIHTAFLVHRGIVNLKEWTNSDGPLKDMQFGNKMAVLSGDFLLANACTGLAQLNDTKVVELISSAIGDVVQGIYHESSGSAEEDSLTVASWEDQAFLSHGALLAKSCQAAMKLARHNTEAQNLAFQYGKHLALGHKLNSELQPFVKSGSEGAVFHLDSAPVVFHRQIVGPERWQQQLKQAQNMSRQIDYTKLRGLIKMERGVSQALDLCSYHGNKALEAMKCFPPSDARSALENMACALNKF | |
Gene Information
Entrez Gene ID
Gene Name
prenyl (decaprenyl) diphosphate synthase, subunit 2
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008299 | IEA:InterPro | P | isoprenoid biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
prenyl (decaprenyl) diphosphate synthase, subunit 2
Protein Entry
Q6DHQ9_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011810 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 50539770 | RefSeq | NP_001002351 | 370 | decaprenyl-diphosphate synthase subunit 2 |
Identical Sequences to LMP011810 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50539770 | GenBank | AAH75908.1 | 370 | Prenyl (decaprenyl) diphosphate synthase, subunit 2 [Danio rerio] |
Related Sequences to LMP011810 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:50539770 | GenBank | ABE02389.1 | 384 | hypothetical protein [Siniperca chuatsi] |
| GI:50539770 | GenBank | AHH40280.1 | 379 | Decaprenyl-diphosphate synthase subunit 2 [Ictalurus punctatus] |
| GI:50539770 | RefSeq | XP_003445490.1 | 385 | PREDICTED: decaprenyl-diphosphate synthase subunit 2-like [Oreochromis niloticus] |
| GI:50539770 | RefSeq | XP_005738845.1 | 385 | PREDICTED: decaprenyl-diphosphate synthase subunit 2-like [Pundamilia nyererei] |
| GI:50539770 | RefSeq | XP_005933914.1 | 385 | PREDICTED: decaprenyl-diphosphate synthase subunit 2-like isoform X1 [Haplochromis burtoni] |
| GI:50539770 | RefSeq | XP_006626097.1 | 374 | PREDICTED: decaprenyl-diphosphate synthase subunit 2-like [Lepisosteus oculatus] |