Gene/Proteome Database (LMPD)
Proteins
| fatty acid binding protein 11a | |
|---|---|
| Refseq ID | NP_001004682 |
| Protein GI | 52219194 |
| UniProt ID | Q66I80 |
| mRNA ID | NM_001004682 |
| Length | 134 |
| RefSeq Status | PROVISIONAL |
| MVDKFVGTWKMTTSDNFDEYMKAIGVGFATRQVGNRTKPNLVVCVDEQGLICMKSQSTFKTTEIKFKLNEPFEETTADDRKTTTVMTIENGKLVQKQTWDGKESTIEREVSDGKLIAKCKMGDVVAVRTYVKEA | |
Gene Information
Entrez Gene ID
Gene Name
fatty acid binding protein 11a
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:InterPro | F | lipid binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
fatty acid binding protein 11a
Protein Entry
Q66I80_DANRE
UniProt ID
Species
Zebrafish
Identical and Related Proteins
Unique RefSeq proteins for LMP011867 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 52219194 | RefSeq | NP_001004682 | 134 | fatty acid binding protein 11a |
Identical Sequences to LMP011867 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:52219194 | GenBank | AAH81489.1 | 134 | Fatty acid binding protein 11a [Danio rerio] |
| GI:52219194 | GenBank | AAV32091.2 | 134 | fatty acid-binding protein H6-isoform [Danio rerio] |
Related Sequences to LMP011867 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:52219194 | GenBank | AAC60351.1 | 134 | fatty acid binding protein H6-isoform [Cryodraco antarcticus] |
| GI:52219194 | GenBank | ACO10083.1 | 134 | Myelin P2 protein [Osmerus mordax] |
| GI:52219194 | GenBank | ADA70027.1 | 134 | adipocyte fatty acid-binding protein [Cyprinus carpio] |
| GI:52219194 | GenBank | AEZ53130.1 | 134 | fatty acid-binding protein [Onychostoma macrolepis] |
| GI:52219194 | RefSeq | XP_007249380.1 | 133 | PREDICTED: myelin P2 protein-like [Astyanax mexicanus] |
| GI:52219194 | RefSeq | XP_008299355.1 | 133 | PREDICTED: fatty acid-binding protein, heart-like [Stegastes partitus] |